KEGG   Podospora anserina: PODANSg9040Help
Entry
PODANSg9040       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PODANSg9040
Peptidases [BR:pan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PODANSg9040
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 1209 aa AA seqDB search
MTGPDPLLSASPIPGFANLTLQADNQHNGDAVSPNAMLLDQPEEHIVEPNGTESEDVAII
NPDSMETDVVLATDSMFEHTRPATCCPTPGSADPVIGDAMKEIVLPPLAEEPRILEDVVH
TWEVQGWRTMNKKERGPIFQAGGYPWRILLFPHGNNVLDQCSIYLEHGFDTNSVPDNWSC
CVQFALVLWNPKDPSLMFHHSAHHRFTKEESDWGFTRFLECRKMFNVVWETADRPLVEND
AANITAFVRVVEDETGVLWHNFNNYDSKKETGYVGLKNQGATCYLNSLLQSLYFTNAFRK
AIYSIPTEHEEDMKNSAYTLQRLFYQLQTSNVAVSTNELTKSFGWETRHIFEQQDVQELS
RKLMERMEDKMKGTDLEKALPMMFSGKIKTYISCINVPYESSRVEDFWDVQLNVSGNANL
LDSFQDYIQVEKLDGENQYFAGDTYKLQDADKGVIFNSFPDVLHLQLKRFEYDINLDTMM
KINDRYEFPEEFDASAYLSKEADRSEPWEYELHGVLVHSGDLNAGHYYAFLKPEKDGWWY
KYDDDKVTKATKREVLEENFGGFYKTTGGRPQLNAKKQPIMRPNSAYMLVYIRKSRLDKI
LCPVTPADAPEHLQKKFEQEHAAREAKRKEREEQHLYLGVKAVTDETFKAHGGVDLTAFD
AAVGSEPGSYKQYKLLRTASMADLANEIAADIGEDPRRVRLWIMVNRQNKTVRPDQPVMD
LRPTVEETYSRATAHRDQALRVWVEIADEVDADGAAVWPTYPGLPNGVVVKNDLILLFLK
WFDVESQCLRGVGHIYFSKEKKVEDLIPVILKKMNWGEKLPSDEKIMLWEEIKPSMIEGL
KVKLTLKAAELQDGDIICFQRTRDEKKYKLGLGAERQGSEETAVDRYEDVRDYYDFLNNK
KNVDFHAHPQKCDPKQYPEFSLVLNTKMNYDKLCEKVGEKLNVEPTHLRFYTVNASSNNP
RTAVKRGHQSLANILIPAGYGQLNMNQRNDALYFEVLDMSLAELDTKKSIKITWLSEGIT
KEEQFDVLVPKSGQVEDLIEALVKKAKIPSEEEAGKIRVYETSSHHKWFRDLARDYSVLS
INDYTSVIAERMPAEDAAVSDQANFISCFHFHGEPSRAHGIPFRFLVKEGEKFADTKKRL
EQRTGIKGKSFEKIKFAVIRRSSFSRPQYLEDDDILWDIATNTDDLLGLDHPDRARTTRN
GAGDLFLKG
NT seq 3630 nt NT seq  +upstreamnt  +downstreamnt
atgactgggcccgatcccctcctctcggcctcaccaatccccggctttgctaacctgact
cttcaggccgacaaccagcacaatggcgacgctgtgtcgccgaatgccatgctgctagac
caacccgaagaacatatcgtcgagccaaacggcaccgagtccgaagatgtcgccatcatc
aatcccgacagcatggagacggatgttgtactcgccacagatagtatgtttgaacacacc
cgacctgccacttgttgtcccacgcccggcagtgctgaccccgtgataggtgatgccatg
aaggaaatagtgcttcctccgctcgccgaagagccccggattctcgaagatgtcgtccac
acctgggaagtgcaaggatggcgcacgatgaataagaaggagcgagggcccatattccag
gctggaggttacccatggcggatcctactctttccacacggcaataatgtcttggaccag
tgctccatttacctggagcatggtttcgacaccaacagtgttcccgacaactggagctgc
tgtgtgcagtttgccctcgtcctgtggaatcccaaagacccatccttaatgtttcatcac
tcggcgcatcatcgattcaccaaggaggagagcgactggggcttcactaggtttctggag
tgccggaagatgttcaatgttgtctgggagactgcagacaggcctctggtggaaaacgat
gctgccaacatcaccgctttcgtcagagttgtcgaggacgaaacgggcgttttatggcac
aacttcaacaactacgattccaagaaggagactggctacgttggtcttaagaaccaaggc
gctacctgttacctcaactcactcctccagtcattatactttaccaatgcgttccgcaag
gccatttacagcatccccacagagcacgaagaggatatgaaaaacagcgcttatacactg
cagagactcttctaccaacttcagacttcgaacgtcgctgttagcaccaacgagctcacc
aagtcttttggctgggaaacgcggcacatttttgagcagcaagatgtgcaagagctttct
aggaagctcatggagcgtatggaggacaagatgaagggcaccgacctggaaaaggcgctt
cccatgatgttcagcggcaagatcaaaacctacatctcctgcatcaacgtcccctacgaa
tcaagtcgcgtcgaggacttttgggacgttcagcttaatgtcagcgggaacgcgaatctg
ctggatagttttcaagactacatccaggtggagaagctcgacggagaaaaccagtacttt
gccggagacacgtacaagttgcaggacgccgacaagggagtcatcttcaacagcttcccg
gacgtcctccatttgcagctgaagcggttcgagtacgacatcaacctcgacactatgatg
aagatcaatgatcgctacgagtttcccgaggagtttgatgcctcggcctatctgtcaaag
gaggctgataggtccgagccatgggaatacgagcttcacggtgttctggtacacagcggt
gatctcaatgcgggtcactactatgcgttcctgaaaccagaaaaggatggctggtggtac
aaatatgacgatgataaggtcaccaaggccacgaaacgcgaggtcctggaggagaacttt
ggcggcttctacaagacaactggtggccgtccccaactcaacgccaagaaacaacccatc
atgcggccaaacagcgcctacatgctggtttacatccggaagtcgagattggacaagatt
ctctgccctgtcacgccagccgatgctccggaacacctccagaaaaagttcgagcaagaa
catgctgcccgtgaagctaagcgcaaggagagagaagaacaacacctttacctcggggtc
aaagccgtcacagatgagacgttcaaggctcatggcggagttgacctgacggcatttgat
gccgccgtgggttcggagccgggctcctacaagcagtacaagctccttcgcacggcgtca
atggcagacttggccaacgagatagccgccgacattggagaggatccaagacgcgtgcga
ttatggatcatggtgaaccggcaaaacaagacagtcagaccagaccagccagtgatggat
cttcgcccgacagtcgaagagacgtacagcagagccacggcacaccgggatcaagcgctc
cgtgtgtgggttgaaattgctgacgaagtcgacgctgatggggctgccgtctggccgacc
tatcccgggctcccgaatggtgtggttgtcaaaaatgacttgatcctactcttcctgaaa
tggttcgacgtcgagtcgcagtgcttgcggggtgttggccacatttatttcagcaaggaa
aagaaggttgaggatctcattccggtcattttgaaaaagatgaactggggcgagaagctg
cccagtgacgaaaagatcatgttgtgggaggaaatcaagcctagcatgatcgagggtctc
aaggtcaagctgacgctgaaagctgccgagcttcaagatggagacattatttgcttccag
cgaacccgtgacgagaagaagtacaaattggggctcggcgccgaaaggcagggctctgaa
gaaacggcggtcgatcgctacgaggatgttcgggattactacgactttctcaacaacaag
aagaatgtggatttccacgctcacccccagaagtgcgatcccaagcagtacccggagttc
agtctggttctcaacacgaaaatgaactacgacaagctgtgtgagaaggttggtgagaag
ctcaacgttgagccaacgcacctgcggttttacacggttaatgctagctctaacaacccc
cggacggcggtgaagcgtgggcatcagtcgttggccaacatcctcatcccggccggttac
ggacaacttaacatgaatcagcgtaacgatgctctgtattttgaggtgctcgacatgagc
ttggccgagttggataccaagaagagcatcaaaatcacgtggctgagtgagggcatcacc
aaggaggagcagttcgatgtgttggtgcccaagagcggccaggtggaagaccttatcgag
gctctggtcaagaaggccaaaattcccagcgaggaagaggcgggcaagatccgcgtctat
gaaactagcagtcatcacaagtggttcagagatctggccagagactattcggtgctcagc
attaacgattacacgtcggtgatagctgagcggatgcccgctgaggatgctgcggtttcg
gaccaagcaaacttcatttcctgcttccacttccacggcgagcccagcagagcgcatgga
atcccgttccgattcttggtcaaggaaggagagaagtttgccgacaccaagaagcggctg
gaacagcgcactggtatcaagggcaagagttttgagaagatcaaatttgctgtgatccgg
agatcatcattctcacgacctcaatatttggaagatgacgatattctgtgggacattgca
acgaacacggatgatctgttgggattagaccaccccgatcgggcacgaacaacacggaac
ggcgctggagacttgttcctcaagggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system