KEGG   Podospora anserina: PODANSg9061Help
Entry
PODANSg9061       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
pan  Podospora anserina
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pan00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    PODANSg9061
Enzymes [BR:pan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     PODANSg9061
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 366 aa AA seqDB search
MVLLKSFMLAGLTAVVAAKSAVLDLIPSNFDEVVLKSGKPTLVEFFAPWCGHCKSLAPVY
EELAHAFEFTKDVQIAKVDADAERSLGKRFGVQGFPTLKWFDGKSDKPTEYNGGRDLEAL
TAFITEKTGIKSKKKLAPPSSVTYLTDATFKNTIGGDKHVLVAFTAPWCGHCKSLAPTWE
SLATTFANEPNVVIAKVDAEAENSKATANDYGVTSYPTIKFFPKGSTTPEDYNGGRSEEA
FVAFLNEQAGTHRAAGGGVDATAGTFAVLDEIVTKYIGGTPLTDAAAEVKKAAESLKEDA
QYKYAEYYIRVFDKLSKSDSFAAKELARLEGILKKGGLAPTKLDELTTKTNILRKFVEKV
TGKDEL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggttctcctcaagagcttcatgctcgccggcctcacggctgttgtcgcggccaagtct
gccgtcctcgaccttatccctagcaacttcgacgaagtcgtcctcaagtccgggaagccc
accctcgtcgagttcttcgccccatggtgtggccattgcaagagccttgctcctgtctat
gaggagctcgcccacgccttcgagttcaccaaggatgtccagattgccaaggttgatgcc
gatgccgaaaggtcgttgggcaagcgttttggtgtccagggtttccctacactgaagtgg
ttcgatggcaagagtgacaagccaacagagtacaatggtggacgtgacctcgaggctctg
accgccttcatcaccgagaagactggtatcaagtccaagaaaaagctcgctcctcccagt
agtgttacctacctgaccgatgctaccttcaagaacaccattggcggtgacaagcacgtt
cttgttgctttcactgctccctggtgcggacactgcaagagccttgcccccacttgggag
tctcttgccaccaccttcgccaacgagcccaacgtcgtcattgccaaggttgatgccgag
gctgagaacagcaaggccaccgccaacgattatggtgtgacctcgtatcccaccatcaag
ttcttccccaagggcagcaccactcccgaggactacaacggtggccgttctgaggaggcc
tttgttgccttcctcaacgagcaggccggtacccaccgcgccgccggcggcggtgttgat
gccaccgctggcaccttcgccgttctcgatgagattgtcaccaagtacattggtggcacc
ccccttaccgatgccgctgccgaggtcaagaaggctgctgagagcctcaaggaggatgcc
cagtacaagtacgccgagtactacatccgcgtctttgacaagcttagcaagagcgacagt
tttgctgctaaggagctcgcccgtttggagggtatcctcaagaagggtggtctggcccct
accaagcttgatgagcttaccaccaagaccaacatcctccgcaagtttgtcgagaaggtc
actggcaaggatgagctttaa

DBGET integrated database retrieval system