KEGG   Podospora anserina: PODANSg9085Help
Entry
PODANSg9085       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pan  Podospora anserina
Brite
Protein phosphatases and associated proteins [BR:pan01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     PODANSg9085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg EF-hand_4
Motif
Other DBs
NCBI-GeneID: 6196689
NCBI-ProteinID: XP_001912039
UniProt: B2B7T9
Position
2
AA seq 174 aa AA seqDB search
MGNQTSSVLDNIVQGSNFDRDEVDRLRKRFMKLDKDNSGTIEREEFLSLPQISSNPLATR
MIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEQKLRFAFKVYDIDRDGYISNGELFIVLK
MMVGNNLKDQQLQQIVDKTIMEADLDKDGKISFEEFTKMVENTDVSMSMTLDQF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccagaccagcagcgtgctggacaacattgttcaggggtccaacttcgacagg
gatgaagttgaccggctgcggaagaggtttatgaagttggataaggataactccggcact
atcgagcgcgaggagttcctttcgctccctcaaatatcctccaacccactcgccaccaga
atgattgccatcttcgacgaagacggcggcggcgacgtcgacttccaagagttcgtctct
ggcctttccgccttctcctccaagggcaacaaggagcagaagctccggttcgccttcaag
gtctacgacattgaccgtgacggctacatctccaacggcgagctgttcatcgtcctgaag
atgatggtgggcaacaacctcaaggaccagcagctgcagcagattgtggacaagaccatc
atggaggccgacctggacaaggacgggaagatcagttttgaggagtttaccaagatggtg
gagaatacggatgtcagcatgagtatgacgctagatcaattctag

DBGET integrated database retrieval system