KEGG   Podospora anserina: PODANSg9085Help
Entry
PODANSg9085       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
pan  Podospora anserina
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 174 aa AA seqDB search
MGNQTSSVLDNIVQGSNFDRDEVDRLRKRFMKLDKDNSGTIEREEFLSLPQISSNPLATR
MIAIFDEDGGGDVDFQEFVSGLSAFSSKGNKEQKLRFAFKVYDIDRDGYISNGELFIVLK
MMVGNNLKDQQLQQIVDKTIMEADLDKDGKISFEEFTKMVENTDVSMSMTLDQF
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccagaccagcagcgtgctggacaacattgttcaggggtccaacttcgacagg
gatgaagttgaccggctgcggaagaggtttatgaagttggataaggataactccggcact
atcgagcgcgaggagttcctttcgctccctcaaatatcctccaacccactcgccaccaga
atgattgccatcttcgacgaagacggcggcggcgacgtcgacttccaagagttcgtctct
ggcctttccgccttctcctccaagggcaacaaggagcagaagctccggttcgccttcaag
gtctacgacattgaccgtgacggctacatctccaacggcgagctgttcatcgtcctgaag
atgatggtgggcaacaacctcaaggaccagcagctgcagcagattgtggacaagaccatc
atggaggccgacctggacaaggacgggaagatcagttttgaggagtttaccaagatggtg
gagaatacggatgtcagcatgagtatgacgctagatcaattctag

DBGET integrated database retrieval system