KEGG   Podospora anserina: PODANSg9124Help
Entry
PODANSg9124       CDS       T01048                                 

Definition
(RefSeq) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
pan  Podospora anserina
Pathway
pan00630  Glyoxylate and dicarboxylate metabolism
pan01100  Metabolic pathways
pan01110  Biosynthesis of secondary metabolites
pan01200  Carbon metabolism
Module
pan_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    PODANSg9124
Enzymes [BR:pan01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     PODANSg9124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-GeneID: 6196642
NCBI-ProteinID: XP_001912078
UniProt: B2B7X8
Position
2
AA seq 548 aa AA seqDB search
MAANNMVNPAVDPNIEDELFAKEVAEVKKWWSEPRWRYTKRPFTAEQIVNKRGNLKIEYA
SNAQAKKLWKILEGRFQNKDASYTYGCLEPTMVTQMAKYLDTVYVSGWQSSSTASASDEP
GPDLADYPYTTVPNKVGHLFMAQLFHDRKQRQERLSVPKAQRAKLANIDYLRPIIADADT
GHGGLTAVMKLTKLFIEKGAAGIHIEDQAPGTKKCGHMAGKVLVPISEHINRLIAIRAQA
DIMGSDLLAIARTDAEAATLITTTIDPRDHAFILGTNNADLPDLNELMIAGEKAGKNGAE
LQAIEDQWLAKANLKRFDDHVVDAILSSNLPNQKALAQKYRDSVNGKQLSNKEARAVARG
ILGKDIYFNWDAPRTREGYYRLEGGCDCSINRAIAYAPYCDAIWMESKLPDYKQAEEFAK
GVHAVWPEQKLAYNLSPSFNWKTAMPREEQETYIRRLAGLGYCWQFITLAGLHTTALISD
KFASAYSKIGMRAYGELVQEPEMEGGVDVVKHQKWSGATYVDELQKMVTGGISSTAAMGK
GVTEDQFH
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaacaacatggtcaatcccgccgtggaccccaacattgaggacgagctcttc
gcgaaggaggtggccgaggtcaagaagtggtggagcgagccaagatggcggtacaccaag
cgcccttttaccgctgagcagatcgtcaacaagagaggcaacctcaagatcgagtatgcc
agcaatgcccaggccaagaagctgtggaagattcttgaggggcggttccagaacaaggat
gccagttacacatacggctgcttggagccaacaatggtgacccaaatggccaagtacctc
gacacagtctatgtttccggctggcaatcatcatcaacggcctctgcctctgacgagccc
ggcccggatcttgctgattacccttatactaccgtccccaacaaggtcggccatctcttc
atggcccagcttttccacgaccgcaagcagcgtcaggagcgtctctccgttcccaaggcg
cagcgcgccaagctcgccaacatcgactacctccgtcccatcatcgccgatgccgatacc
ggtcacggtggtcttaccgccgtcatgaagctcaccaagctcttcattgagaagggtgct
gccggtattcacatcgaggatcaggcccctggcaccaagaagtgcggccacatggccggc
aaggttctcgtccccatctccgagcacatcaaccgtctgattgccatccgtgcccaggcc
gacatcatgggctctgacctcctggccattgcccgtactgatgccgaggctgccaccctc
atcaccaccaccatcgatccccgcgaccacgccttcatcctcggcaccaacaacgccgac
ctccccgacctcaacgagctcatgattgctggtgagaaggccggcaagaacggcgccgag
ctccaggccatcgaggaccagtggctcgccaaggccaacctcaagcgcttcgacgaccac
gtcgtggacgccatcctctcctccaacctccccaaccagaaggccctcgcccaaaagtac
cgcgacagcgtcaacggcaagcagctctccaacaaggaggcccgcgccgtcgcccgcggc
atcctcggcaaggacatttacttcaactgggacgccccccgcacccgcgagggctactac
cgtctcgagggcggctgcgactgctccatcaaccgcgccatcgcctacgccccttactgc
gacgccatctggatggagtccaagctccccgactacaagcaggccgaggagttcgccaag
ggcgtccacgccgtctggcccgagcagaagctcgcctacaacctgtctccctctttcaac
tggaagaccgccatgcccagagaggagcaggagacctacatcagacgcctggctggcctg
ggttactgctggcagttcatcaccctcgctggtcttcacaccaccgcccttatcagcgac
aagtttgccagcgcgtacagcaagattggcatgagggcgtatggcgagctggtgcaggag
cctgagatggagggcggtgtggatgtggtcaagcatcagaagtggtcgggtgccacgtac
gtggacgagctgcagaagatggtgactggtggtattagcagtacggctgctatgggtaag
ggtgtgacggaggatcagttccattaa

DBGET integrated database retrieval system