KEGG   Podospora anserina: PODANSg9218Help
Entry
PODANSg9218       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pan  Podospora anserina
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PODANSg9218
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PODANSg9218
  Amino acid metabolism
   00310 Lysine degradation
    PODANSg9218
Enzymes [BR:pan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PODANSg9218
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 420 aa AA seqDB search
MVYRGLRLAARAAPKFALYNNNTALRQLPLQFQHVRTYADKIVKVPQMAESISEGTLKQW
NKSVGDFVEQDEEIATIETDKIDVAVNAPEAGVIKEFLANEEDTVVVGQDLVRIELGGAP
SGDKPAAEPKESAPEKKAEPEKAPEPKQEESKPAASAPPPPKQETPEPKSKPAPAAAPEK
PATLGNREEKRVKMNRMRLRIAERLKQSQNTAASLTTFNEVDMSALMEFRNKYKEEVLKK
TGVKLGFMSAFSRAAVLAMRDIPAVNASIEGPNGGDTIVYRDYVDISVAVATEKGLVTPV
VRNAEAMDLVGIERSIAELGKKARDGKLTIEDMAGGTFTISNGGVFGSLMGTPIINLPQS
AVLGLHATKERPVVVNGKIEIRPMMYLALTYDHRLLDGREAVQFLVKVKEYIEDPRKMLL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggtgtacagaggtctccgccttgcggctcgcgctgctcccaaatttgcgctctacaac
aacaatacagccctgcgacaactgcccctgcagttccaacatgtgcggacatatgccgac
aagatcgtcaaggtgccgcaaatggccgagtcgatcagcgagggtactctgaagcagtgg
aacaagtcagttggtgactttgttgagcaggatgaggagattgcgaccattgagaccgac
aagattgatgttgctgtcaatgctcctgaggccggtgtcatcaaggagttcctcgccaac
gaggaggataccgtcgttgttggccaggatctcgtgcgtatcgagcttggaggtgcgccg
tcgggcgacaagcctgccgctgagcccaaggaatcggctcccgaaaagaaggccgagcct
gagaaggctcccgagcccaagcaggaggagagcaagcctgctgcctctgcccctcccccc
cctaaacaggagacaccagaacccaagagcaagcccgctccagcggccgcccctgagaag
cccgccactctgggcaaccgcgaggagaagagggtcaagatgaaccggatgcgtcttcgc
attgccgagcgcttgaagcagtctcaaaacaccgccgcttccctgaccacattcaacgag
gtcgacatgtcagctctgatggaattccgcaacaagtataaggaggaggttctcaagaag
actggtgtcaagcttggcttcatgagcgctttctcgcgtgctgccgtacttgccatgcgc
gatattcctgccgtcaacgcctcgattgaaggtcccaatggcggtgataccatcgtctac
agggactacgtcgacatcagcgttgctgttgctactgagaagggtctcgttacccctgtt
gtccgcaacgctgaggctatggatcttgttggcatcgagaggtccatcgctgagctgggc
aagaaggctcgcgacggcaagctcactattgaggacatggctggcggcaccttcaccatc
agcaacggtggtgtcttcggttccctcatgggcacccccatcatcaaccttccccaaagc
gccgtgcttggtcttcatgccactaaggagcgcccagttgtcgtcaatggcaagattgag
atccgtcccatgatgtacctggcacttacctatgaccatcgtcttcttgacggcagagag
gccgtgcagttcttggtcaaggtaaaggagtacattgaggatccccgtaagatgcttttg
tag

DBGET integrated database retrieval system