KEGG   Podospora anserina: PODANSg9222Help
Entry
PODANSg9222       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
pan  Podospora anserina
Brite
Exosome [BR:pan04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   PODANSg9222
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 137 aa AA seqDB search
MPPKAADKKPANKAPATASKAPEKKDAGKKTAASGEKKKRTKARKETYSSYIYKVLKQVH
PDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELAKH
AVSEGTKAVTKYSSSTK
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgccccccaaggccgctgacaagaagcccgccaacaaggcccccgccactgcctccaag
gctcccgagaagaaggatgctggcaagaagaccgctgcctctggcgagaagaagaagcgc
accaaggcgcgcaaggagacctactcctcctacatttacaaggtcctcaagcaggtccac
cccgacactggtatctccaaccgtgccatgtccatcctcaactctttcgtgaacgacatc
ttcgagcgcgtcgcgaccgaggcttccaagcttgccgcctacaacaagaagtccaccatc
tcatcccgtgagatccagacctccgtgcgcctcatccttcccggcgagcttgccaagcac
gccgtgtctgaaggcaccaaggccgtcaccaagtactcgtcgagcacgaaatag

DBGET integrated database retrieval system