KEGG   Podospora anserina: PODANSg9249Help
Entry
PODANSg9249       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
pan  Podospora anserina
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 353 aa AA seqDB search
MSNAQARGGARKISFNVSEQYDIQDVVGEGAYGVVCSAIHKPSGQKVAIKKITPFDHSMF
CLRTLREMKLLRYFNHENIISILDIQKPRSYESFNEVYLIQELMETDMHRVIRTQELSDD
HCQYFIYQTLRALKAMHSANVLHRDLKPSNLLLNANCDLKVCDFGLARSAASQEDNSGFM
TEYVATRWYRAPEIMLTFKEYTKAIDVWSVGCILAEMLSGKPLFPGKDYHHQLTLILDVL
GTPTMEDYYGIKSRRAREYIRSLPFKKKVPFRTLFPNTSDMALDLLEKLLAFNPVKRITV
EEALKHPYLEPYHDPEDEPTAPPIPEEFFDFDKHKDNLSKEQLKQLIYQEIMR
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgcacaagctcggggcggtgcccggaagatttccttcaatgtcagcgagcag
tacgacatccaggatgttgttggcgaaggtgcctatggtgtggtttgctctgccatccac
aagccctcaggccaaaaggttgccatcaagaagatcacgccctttgatcactccatgttc
tgcctgcggacattgcgtgaaatgaagctcctccggtacttcaaccatgagaacatcatc
tccattctcgatattcagaagcctagaagctacgaatcatttaatgaggtctacctcatc
caggagctgatggagactgatatgcaccgcgtcatccgcacacaggagctctcggacgat
cattgccagtacttcatctaccagacgctgcgtgccctcaaggccatgcactctgccaac
gttctccaccgcgatttgaagccttccaacttgcttctcaatgccaactgcgatctcaaa
gtgtgcgatttcggtctggctcgttcggcggcgtcacaggaggacaactcgggtttcatg
acagaatacgttgccacccgttggtaccgtgcgcccgagatcatgttgaccttcaaagag
tacaccaaggctattgacgtctggtcggtgggctgcattctcgccgagatgctcagcggc
aagcccctgttcccaggcaaggactaccaccaccagcttaccctcatcctcgacgtcctc
ggcacgccaacaatggaggattattatggcatcaagtccagacgcgcgcgcgagtacatc
cgatcgcttcccttcaagaagaaggtgcccttccgcacgctcttccccaacacgtccgac
atggctctcgacctcctcgagaagctgttggccttcaaccccgtcaagcgcatcaccgtc
gaggaggcgctcaagcacccatacctcgagccgtaccacgaccccgaggacgagccgacc
gcgccgccaatccccgaggagttctttgactttgacaagcacaaggacaacctgagcaag
gagcagttgaagcagctgatttaccaggagattatgaggtaa

DBGET integrated database retrieval system