KEGG   Podospora anserina: PODANSg9284Help
Entry
PODANSg9284       CDS       T01048                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
pan  Podospora anserina
Brite
Enzymes [BR:pan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     PODANSg9284
Peptidases [BR:pan01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   PODANSg9284
Transcription machinery [BR:pan03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     PODANSg9284
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 560 aa AA seqDB search
MSSARPATPASPKNYKVKAAQQGQPMYGCEHLQKLFNQDQVTTNTSIHHYKMILRTIFDQ
TPVVSQTVKVVDTQQVVTTLTPTYLCLQCPSTVTEEDRIKHGNKKSHRFYVDSRSAALYC
QMCDDMVYDPTFEELRLKKLGTSTFSNTRKRKQDELFSPDPVKDSPAYISQNTTTATCKA
NGLRGIYNAGATCYQNVVLQSFLHNPILRNYYLSDGHSGCDTPHCLSCAMDDMFQDFYAV
ENTNGYTAANILSGFWISERKAFENLVTTKEQDAHEFFQFLAEELHERNGDGKKPEIGSE
HSCNCIIHQTFYGKLQTQTTCQNCQGVTNQVQSFLDLSLPLENLTQKKGGKKLLGGKGTM
TLQECLDEEYVKLDKCEYRCNGCNSTQQARRQTSIKRLPNVLSIQLKRFEYKQGRHERAA
KIDTPVQFPLQLNMLPYTTVGRSGDTKDSYELARQCTYDLLSVVVHVGEIDTGHYVSYCR
VGDQVCPFFSLWKMAMLTRLKVVRFQRPQGGSCPEVGRAQRKSLPLVLYCQVVDVGTLLG
FLGRAGWTVSISSNGTGPTF
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccgcgaggcccgccacaccggcgtcgcccaagaactacaaagtcaaagcagcc
cagcaaggccagcccatgtacggttgcgaacacctacagaagctcttcaaccaagatcaa
gtgacgaccaacacatcgatccatcattacaagatgattctccgtacaatattcgaccag
accccggtcgtctcccagacggtgaaggtggtggacactcagcaagttgtcaccactctc
acaccgacctatctttgtcttcagtgcccatcaacggttactgaggaagaccgaataaaa
catggaaacaagaagtcgcaccgtttttatgtcgactcgagaagcgccgctctttactgc
caaatgtgcgacgacatggtctatgacccaacctttgaagagcttcggctgaagaaactc
ggcacaagcacattctccaacacacggaaacgcaagcaagacgagctcttctcgcccgat
cctgtcaaagatagccccgcctacatctcccaaaacaccacgacagcaacctgcaaagcc
aacggtctccgaggcatctacaacgcaggtgccacctgctaccaaaacgtcgttctccag
tcgttccttcacaaccccatcctccgaaactactacctgagcgacggccactcgggctgc
gacaccccccactgcctttcctgcgccatggatgacatgtttcaagacttttacgccgtg
gaaaacaccaatggctatacggcggccaatatcctcagtggattctggatctcggagcgg
aaagcctttgaaaatctcgtcacgaccaaggagcaagacgcgcacgagtttttccagttc
ttggccgaggagctgcacgagaggaacggtgacgggaagaaaccagagattgggagtgag
cacagctgtaactgcatcatccaccagactttttatggtaaactgcaaacgcagacaacg
tgccagaattgtcagggagtgacgaaccaagtacaaagctttttggacttgagtctgccg
ctggagaatctgacgcagaaaaagggagggaagaagctgctggggggcaaggggacgatg
acgctgcaagagtgcttggatgaggagtatgtcaagcttgataagtgcgagtataggtgt
aatggatgtaattcgacgcagcaggcgaggagacagacgagtatcaagcggttgccgaat
gtgctgtcgattcagctgaagagattcgagtacaagcaaggccgtcatgagcgagcagcc
aagatcgacaccccggttcagttcccgctgcagttgaatatgctgccttatacgactgtt
ggccggtctggggacacaaaagatagctacgagctggcgaggcagtgcacgtatgatttg
ttgagtgtggtggtgcacgtgggggagattgatacggggcattatgtgtcgtattgtcgg
gttggtgatcaggtatgtcccttcttttcactttggaagatggcaatgctaacaagactg
aaagtggttcgctttcaacgaccacaaggtggaagttgcccagaagtcggacgtgctcaa
cgcaaaagcctacctcttgttttatattgtcaggtcgttgacgtaggaaccttgctgggt
ttcttaggcagagctggttggactgtctccatatcgtccaatggaacggggccgaccttt
tga

DBGET integrated database retrieval system