KEGG   Planococcus antarcticus: BBH88_06790Help
Entry
BBH88_06790       CDS       T04428                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pana  Planococcus antarcticus
Pathway
pana00071  Fatty acid degradation
pana00072  Synthesis and degradation of ketone bodies
pana00280  Valine, leucine and isoleucine degradation
pana00310  Lysine degradation
pana00362  Benzoate degradation
pana00380  Tryptophan metabolism
pana00620  Pyruvate metabolism
pana00630  Glyoxylate and dicarboxylate metabolism
pana00640  Propanoate metabolism
pana00650  Butanoate metabolism
pana00900  Terpenoid backbone biosynthesis
pana01100  Metabolic pathways
pana01110  Biosynthesis of secondary metabolites
pana01120  Microbial metabolism in diverse environments
pana01130  Biosynthesis of antibiotics
pana01200  Carbon metabolism
pana01212  Fatty acid metabolism
pana02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pana00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BBH88_06790
   00630 Glyoxylate and dicarboxylate metabolism
    BBH88_06790
   00640 Propanoate metabolism
    BBH88_06790
   00650 Butanoate metabolism
    BBH88_06790
  Lipid metabolism
   00071 Fatty acid degradation
    BBH88_06790
   00072 Synthesis and degradation of ketone bodies
    BBH88_06790
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BBH88_06790
   00310 Lysine degradation
    BBH88_06790
   00380 Tryptophan metabolism
    BBH88_06790
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BBH88_06790
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BBH88_06790
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BBH88_06790
Enzymes [BR:pana01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BBH88_06790
Exosome [BR:pana04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBH88_06790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C SpoVAD ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANU10026
UniProt: A0A1C7DEW3
Position
complement(2993148..2994341)
Genome map
AA seq 397 aa AA seqDB search
MAKTVIIDGARTAFGKFGGNLSTLTASELGAEAIKAAMSRAAIQPEDVQEVIMGNVLQAG
QGQIPSRQAATKAGVPYNVKSETINKVCASGMRSVTLADQIIRLGDEEVIVAGGMESMSN
APYYLPKARWGLRMGDAQVIDGMVHDGLSCSFHPDKVHMGTYGNSTAEDFDLTREEQDKW
SARSHELAIKAKDLFAEEIVAIKIPQRKGDPITVDVDEAPRANSTIEALAKLKPAFGKDG
TITAGNAPGINDGAAALVLMSEERAQNEGKNILAHILSHTEVAIEPHRFPETPGIVINEL
LKKTGKSLDDIDLFEINEAFAAVALASSKIAGLDAKKVNVNGGSVALGHPIGASGARIIL
TLAYELKRRGGGIGIAAICSGGGQGDAVMIEVPKEAK
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaacagttattattgatggcgcacgtacggcattcgggaaattcggaggtaac
ttgagtacattgacggcaagtgaacttggtgcagaagcgatcaaagccgcgatgagccgc
gcagctattcaacctgaagatgttcaagaagtaatcatgggtaacgtcctccaggctggg
caagggcaaattccttctcgtcaggcagcgacaaaagctggagttccctataacgtaaag
tctgaaaccatcaataaagtctgtgcatctggcatgcgcagtgtcacattggcagaccaa
atcattcgtttaggtgatgaagaagttattgtcgcgggtggcatggaatccatgtcgaat
gcgccttattatttgccaaaagcacgctggggacttcgtatgggagatgctcaagtcatt
gatggcatggtccatgatggcttgtcttgttcattccatccggacaaggtccacatggga
acttacggcaactcaactgctgaagatttcgacttgacgcgtgaagagcaagataaatgg
tcagctcgttcacatgaacttgcgattaaagcgaaagatttattcgctgaagaaattgtt
gcaattaaaattcctcagcgtaaaggagatcccatcacagttgatgtggatgaagctccg
cgcgccaattcaacaattgaagcattagcaaaattaaagccagcattcggtaaagacggt
acaattactgccggaaacgcacctggcattaatgacggtgcagcagcactggtcttaatg
agcgaagaacgtgcacaaaacgaagggaaaaatatattggcacatattttgtctcataca
gaagtggcgattgagccgcatcgcttccctgaaacgcctggaattgtcattaacgagcta
ttaaagaaaacgggcaaatcgctggatgacattgatttgttcgaaattaatgaagcgttc
gcagcagtcgctttagccagctcgaaaattgctgggttagacgctaaaaaagtcaatgtc
aatggaggttctgtagcactcggtcatccgattggggcaagcggagcacgcattatcttg
acactcgcttacgaattaaaacgccgcggaggcggcatcggcatcgcagcaatctgctca
ggcgggggacaaggcgacgcggttatgatcgaagttcctaaggaggcaaaataa

DBGET integrated database retrieval system