KEGG   Pantoea sp. At-9b: Pat9b_0065Help
Entry
Pat9b_0065        CDS       T01386                                 

Definition
glycyl-tRNA synthetase subunit beta (EC:6.1.1.14)
Orthology
K01879  
glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
pao  Pantoea sp. At-9b
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:pao00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
71024..73093
Genome map
AA seq 689 aa AA seqDB search
MTDKTFLVEIGTEELPPKALRSLAEAFAAQVTAELDAAGLAHGEVNWFAAPRRLALKVAN
LAAAQPDREVEKRGPAIAAAFDANGNATKAAEGWARGNGITVDQAERLSTDKGEWLVYRA
QVKGESAQTLLPAMIATALSKLPIPKLMRWGASDVQFVRPVHTVTLLLGDELIPATILGI
QSDRVIRGHRFMGEPEITLDHADQYPQLLLERGKVVADYAARKAQIKADAEQAALKLGGN
ADLSDSLLEEVTSLVEWPVVLTATFEEKFLAVPAEALVYTMKGDQKYFPVYANDGKLLPN
FIFVANIESSDPQQIISGNEKVVRPRLADAEFFFNTDRKKRLEDHLPRLETVLFQKELGT
LRDKTDRIQALAGWIAAQIGADVNHATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHD
GEAEDVAVALNEQYQPRFAGDALPSNPVACAVAIADKMDTLAGIFGIGQHPKGDKDPFAL
RRAALGVLRIIVEKNLPLDLQTLTEEAVRLYGSKLSNGNVVDDVIDFMLGRFRTWYQEEG
HSVDTIQAVLARRPTRPADFDARMKAVSHFRTLEAATTLAAANKRVSNILAKSTETLNDS
VQASLLKENEEIQLATFVTALSSKLQPYFAEGRYQDALIELAQLRESVDNFFDKVMVNAD
DQAVRINRLTLLAQLRELFLQVADISLLQ
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataaaactttcctggtggaaattggcaccgaagagttgcctccgaaagcgcta
cgcagcctggcggaagcctttgctgcccaggttaccgctgaactggatgccgctggcctg
gcgcatggtgaggtgaactggttcgccgcaccgcgtcgtctggcgctgaaagtggcaaac
ctggcggccgcacagccggatcgcgaagttgaaaaacgtggcccggctatcgctgccgcg
tttgatgctaacggcaacgccaccaaagctgctgaaggctgggcgcggggtaacggtatt
accgttgatcaggccgagcgtttaagcaccgataaaggcgaatggctggtgtatcgtgca
caggtgaaaggcgagagcgcccagaccctgctgcccgcgatgatcgccactgcgttgagt
aagctgccgattccaaaactgatgcgctggggtgccagcgacgtgcagtttgtgcgtccg
gtccataccgtcacgctgctgctgggtgatgagctgattccggctaccatcctcggtatt
cagtcggatcgcgtgatccgtggtcatcgctttatgggcgagccggaaatcaccctcgac
catgccgaccagtacccgcaactgctgctggaacgcggcaaagtggtggcggactacgct
gcccgtaaagcacagatcaaagctgatgctgagcaagcggcgctgaaactcggcggcaat
gctgacctgagcgacagcctgctggaagaagtgacttcgctggtggagtggccggtagta
ctgactgccactttcgaagagaaattcctcgccgtaccggcagaagcactggtgtacacc
atgaaaggtgaccagaaatacttcccggtctacgccaacgacggcaaactgctgccgaac
tttatcttcgttgccaacatcgaatccagcgatccgcagcagatcatctccggtaacgag
aaggtggtacgtccgcgtctggcagatgccgaattcttcttcaacaccgaccgcaaaaag
cgtctggaagatcacctgccgcgtctggaaaccgtgttgttccagaaagaactgggtacg
ctgcgtgataaaaccgaccgtattcaggcgctggctggctggattgccgcgcaaatcggt
gccgatgtcaatcacgcgacccgtgctggtctgctgtccaaatgtgacctgatgaccaac
atggtgttcgagttcaccgacacccagggtgtgatgggcatgcactacgcgcgtcatgat
ggtgaagcggaagatgtggcggtggcgctgaacgaacagtatcagccgcgctttgccggt
gatgcgctgccgtctaacccggttgcctgtgctgtggcgattgctgacaagatggatacc
ctcgcgggcatcttcgggattggtcagcatccgaaaggcgataaagacccgtttgcgctg
cgccgcgctgcgctgggtgtgctgcgtattatcgttgagaagaacctgccgcttgatctg
caaaccctcaccgaggaagcggtgcgtctgtacggcagcaagctgagcaacggcaatgtt
gtggatgatgtcatcgactttatgctgggtcgtttccgtacctggtatcaggaagaaggc
cacagcgtggacaccattcaggcggtgctggcgcgtcgtccgacccgtccggctgatttc
gatgcccgtatgaaggcggtttcgcatttccgtaccctggaagcggcaaccaccctggcc
gccgctaacaagcgtgtttccaacattctggcgaaatcgaccgaaacgctgaacgacagc
gtgcaggcttcgttgctgaaagagaacgaagagatccagctggccaccttcgtgacggcg
ttgagcagcaagctgcaaccgtacttcgcagaaggtcgctatcaggatgcgttgattgaa
ctggcgcaactgcgtgagtccgtcgataacttcttcgacaaagtcatggtaaacgcggat
gaccaggcggtacgtattaaccgtctgacattgctggcccaactgcgcgagctgttcctg
caagtggcggatatttcgctgttgcagtaa

DBGET integrated database retrieval system