KEGG   Pantoea sp. At-9b: Pat9b_0065Help
Entry
Pat9b_0065        CDS       T01386                                 

Definition
glycyl-tRNA synthetase subunit beta (EC:6.1.1.14)
Orthology
K01879  
glycyl-tRNA synthetase beta chain [EC:6.1.1.14]
Organism
pao  Pantoea sp. At-9b
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:pao00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Pat9b_0065
Enzymes [BR:pao01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     Pat9b_0065
Amino acid related enzymes [BR:pao01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   Pat9b_0065
Transfer RNA biogenesis [BR:pao03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Pat9b_0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
71024..73093
Genome map
AA seq 689 aa AA seqDB search
MTDKTFLVEIGTEELPPKALRSLAEAFAAQVTAELDAAGLAHGEVNWFAAPRRLALKVAN
LAAAQPDREVEKRGPAIAAAFDANGNATKAAEGWARGNGITVDQAERLSTDKGEWLVYRA
QVKGESAQTLLPAMIATALSKLPIPKLMRWGASDVQFVRPVHTVTLLLGDELIPATILGI
QSDRVIRGHRFMGEPEITLDHADQYPQLLLERGKVVADYAARKAQIKADAEQAALKLGGN
ADLSDSLLEEVTSLVEWPVVLTATFEEKFLAVPAEALVYTMKGDQKYFPVYANDGKLLPN
FIFVANIESSDPQQIISGNEKVVRPRLADAEFFFNTDRKKRLEDHLPRLETVLFQKELGT
LRDKTDRIQALAGWIAAQIGADVNHATRAGLLSKCDLMTNMVFEFTDTQGVMGMHYARHD
GEAEDVAVALNEQYQPRFAGDALPSNPVACAVAIADKMDTLAGIFGIGQHPKGDKDPFAL
RRAALGVLRIIVEKNLPLDLQTLTEEAVRLYGSKLSNGNVVDDVIDFMLGRFRTWYQEEG
HSVDTIQAVLARRPTRPADFDARMKAVSHFRTLEAATTLAAANKRVSNILAKSTETLNDS
VQASLLKENEEIQLATFVTALSSKLQPYFAEGRYQDALIELAQLRESVDNFFDKVMVNAD
DQAVRINRLTLLAQLRELFLQVADISLLQ
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataaaactttcctggtggaaattggcaccgaagagttgcctccgaaagcgcta
cgcagcctggcggaagcctttgctgcccaggttaccgctgaactggatgccgctggcctg
gcgcatggtgaggtgaactggttcgccgcaccgcgtcgtctggcgctgaaagtggcaaac
ctggcggccgcacagccggatcgcgaagttgaaaaacgtggcccggctatcgctgccgcg
tttgatgctaacggcaacgccaccaaagctgctgaaggctgggcgcggggtaacggtatt
accgttgatcaggccgagcgtttaagcaccgataaaggcgaatggctggtgtatcgtgca
caggtgaaaggcgagagcgcccagaccctgctgcccgcgatgatcgccactgcgttgagt
aagctgccgattccaaaactgatgcgctggggtgccagcgacgtgcagtttgtgcgtccg
gtccataccgtcacgctgctgctgggtgatgagctgattccggctaccatcctcggtatt
cagtcggatcgcgtgatccgtggtcatcgctttatgggcgagccggaaatcaccctcgac
catgccgaccagtacccgcaactgctgctggaacgcggcaaagtggtggcggactacgct
gcccgtaaagcacagatcaaagctgatgctgagcaagcggcgctgaaactcggcggcaat
gctgacctgagcgacagcctgctggaagaagtgacttcgctggtggagtggccggtagta
ctgactgccactttcgaagagaaattcctcgccgtaccggcagaagcactggtgtacacc
atgaaaggtgaccagaaatacttcccggtctacgccaacgacggcaaactgctgccgaac
tttatcttcgttgccaacatcgaatccagcgatccgcagcagatcatctccggtaacgag
aaggtggtacgtccgcgtctggcagatgccgaattcttcttcaacaccgaccgcaaaaag
cgtctggaagatcacctgccgcgtctggaaaccgtgttgttccagaaagaactgggtacg
ctgcgtgataaaaccgaccgtattcaggcgctggctggctggattgccgcgcaaatcggt
gccgatgtcaatcacgcgacccgtgctggtctgctgtccaaatgtgacctgatgaccaac
atggtgttcgagttcaccgacacccagggtgtgatgggcatgcactacgcgcgtcatgat
ggtgaagcggaagatgtggcggtggcgctgaacgaacagtatcagccgcgctttgccggt
gatgcgctgccgtctaacccggttgcctgtgctgtggcgattgctgacaagatggatacc
ctcgcgggcatcttcgggattggtcagcatccgaaaggcgataaagacccgtttgcgctg
cgccgcgctgcgctgggtgtgctgcgtattatcgttgagaagaacctgccgcttgatctg
caaaccctcaccgaggaagcggtgcgtctgtacggcagcaagctgagcaacggcaatgtt
gtggatgatgtcatcgactttatgctgggtcgtttccgtacctggtatcaggaagaaggc
cacagcgtggacaccattcaggcggtgctggcgcgtcgtccgacccgtccggctgatttc
gatgcccgtatgaaggcggtttcgcatttccgtaccctggaagcggcaaccaccctggcc
gccgctaacaagcgtgtttccaacattctggcgaaatcgaccgaaacgctgaacgacagc
gtgcaggcttcgttgctgaaagagaacgaagagatccagctggccaccttcgtgacggcg
ttgagcagcaagctgcaaccgtacttcgcagaaggtcgctatcaggatgcgttgattgaa
ctggcgcaactgcgtgagtccgtcgataacttcttcgacaaagtcatggtaaacgcggat
gaccaggcggtacgtattaaccgtctgacattgctggcccaactgcgcgagctgttcctg
caagtggcggatatttcgctgttgcagtaa

DBGET integrated database retrieval system