KEGG   Pantoea sp. At-9b: Pat9b_0118Help
Entry
Pat9b_0118        CDS       T01386                                 

Definition
(GenBank) glycoside hydrolase family 8
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
pao  Pantoea sp. At-9b
Brite
Enzymes [BR:pao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Pat9b_0118
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
133998..135005
Genome map
AA seq 335 aa AA seqDB search
MSVKPFWRQWILCFMVMFFSAQAAADGWSTFKSRFMSSDGRISDTANNNVSHTEGQGYGM
LLAVANDDRPTFDKLWQWTQTHLRNPQNDLFYWRYTPGASDPIADKNNASDGDVLIAWAL
QRGAQKWSVNSYQQASDRIQRAIVKHNVITYAGHTVMLPGVQGFNKTSFIVLNPSYFLFP
AWREFAQQSHLRVWNQLIEDGMDLLGDMHFGKTGLPLDWVALNADGSVAPAVGYSNRFSY
DAIRIPLNIWWYDPQSLRLVPYQRVWQGYGRLTTPAWFDVLANTPAPYNLDGGLLAIRDL
TLSETGYLSDRLAPDQNYFSASLQLLTWMAYQERR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttaagccgttctggcgtcaatggatactctgtttcatggtgatgttttttagt
gcccaggcggccgcagatggctggagtacctttaagagtcgctttatgagcagcgatggt
cgtatcagcgatacggccaataacaatgtcagccataccgaaggtcagggttacggcatg
ttgctggcggtagcgaatgacgatcgcccgacctttgataagctgtggcagtggacgcag
acccatctgcgcaatccgcaaaacgatctgttttactggcgctatacccctggtgcgtct
gaccccatcgctgacaaaaataacgcgtcggatggtgatgtgctgattgcctgggcgttg
cagcgtggtgcgcagaagtggtccgttaacagctaccagcaggcgtcggatcgtattcag
cgcgcgattgtgaagcacaacgtgatcacctatgccgggcacaccgtgatgctgccgggc
gtgcagggtttcaacaaaaccagttttatcgttctcaacccgtcctatttcctgtttccg
gcctggcgtgagtttgcacagcaaagccatttgcgtgtctggaatcagttaatcgaagat
ggtatggacctgctgggcgatatgcattttggtaaaacgggtttgccgcttgattgggtg
gcgctgaatgccgacggttcggtcgcaccggcggtcgggtattccaatcgcttcagctat
gacgcgattcgcatcccgctgaatatctggtggtacgatccacaaagcctgcgtctggtg
ccgtaccagcgtgtctggcagggctatggacgtttaaccacgccagcgtggtttgatgtg
ctggcgaatacgcctgccccttataacctcgacggcgggctgctggcgatccgggatttg
acgttgagcgagacggggtatttgagtgatcggctggcacccgatcagaactacttctcg
gccagtttgcagttgctgacctggatggcgtatcaggaaaggcgctga

DBGET integrated database retrieval system