KEGG   Pantoea sp. At-9b: Pat9b_0118Help
Entry
Pat9b_0118        CDS       T01386                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
pao  Pantoea sp. At-9b
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pao00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
133998..135005
Genome map
AA seq 335 aa AA seqDB search
MSVKPFWRQWILCFMVMFFSAQAAADGWSTFKSRFMSSDGRISDTANNNVSHTEGQGYGM
LLAVANDDRPTFDKLWQWTQTHLRNPQNDLFYWRYTPGASDPIADKNNASDGDVLIAWAL
QRGAQKWSVNSYQQASDRIQRAIVKHNVITYAGHTVMLPGVQGFNKTSFIVLNPSYFLFP
AWREFAQQSHLRVWNQLIEDGMDLLGDMHFGKTGLPLDWVALNADGSVAPAVGYSNRFSY
DAIRIPLNIWWYDPQSLRLVPYQRVWQGYGRLTTPAWFDVLANTPAPYNLDGGLLAIRDL
TLSETGYLSDRLAPDQNYFSASLQLLTWMAYQERR
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttaagccgttctggcgtcaatggatactctgtttcatggtgatgttttttagt
gcccaggcggccgcagatggctggagtacctttaagagtcgctttatgagcagcgatggt
cgtatcagcgatacggccaataacaatgtcagccataccgaaggtcagggttacggcatg
ttgctggcggtagcgaatgacgatcgcccgacctttgataagctgtggcagtggacgcag
acccatctgcgcaatccgcaaaacgatctgttttactggcgctatacccctggtgcgtct
gaccccatcgctgacaaaaataacgcgtcggatggtgatgtgctgattgcctgggcgttg
cagcgtggtgcgcagaagtggtccgttaacagctaccagcaggcgtcggatcgtattcag
cgcgcgattgtgaagcacaacgtgatcacctatgccgggcacaccgtgatgctgccgggc
gtgcagggtttcaacaaaaccagttttatcgttctcaacccgtcctatttcctgtttccg
gcctggcgtgagtttgcacagcaaagccatttgcgtgtctggaatcagttaatcgaagat
ggtatggacctgctgggcgatatgcattttggtaaaacgggtttgccgcttgattgggtg
gcgctgaatgccgacggttcggtcgcaccggcggtcgggtattccaatcgcttcagctat
gacgcgattcgcatcccgctgaatatctggtggtacgatccacaaagcctgcgtctggtg
ccgtaccagcgtgtctggcagggctatggacgtttaaccacgccagcgtggtttgatgtg
ctggcgaatacgcctgccccttataacctcgacggcgggctgctggcgatccgggatttg
acgttgagcgagacggggtatttgagtgatcggctggcacccgatcagaactacttctcg
gccagtttgcagttgctgacctggatggcgtatcaggaaaggcgctga

DBGET integrated database retrieval system