KEGG   Pantoea sp. At-9b: Pat9b_0172Help
Entry
Pat9b_0172        CDS       T01386                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
pao  Pantoea sp. At-9b
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:pao00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
201181..202173
Genome map
AA seq 330 aa AA seqDB search
MQQIKQSWLRREKAFASFATGPLLDFWHRREECEFTGVGNLTLRYVRFTSPQHHRVILIV
PGRIESYIKYPELAYDLFHCGFDVVIIDHRGQGRSDRLLEDSHRGHVVDFNDYVDDLETL
YLKEIVSGHYRQRYALAHSMGGAILALFLARQPRAFHAVALAAPMFGITLPLPPFLAHRI
LDWAEKMPALRDGYALGTGRWRAHPFGINQLTHSRERYQRNLRFYADDPAIRVGGPTYHW
VREGVQAGRSIISQVNNITTPMLLMQASEDRVVDNRSQDLFCEAMAAAGHPCEGVTPYVI
EGARHEILFETDAMRAQALNAVVDFFARHV
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagataaaacagagttggctcaggcgtgaaaaggcgtttgcctcctttgctacc
ggaccgctgctcgacttctggcaccgccgcgaagagtgtgaatttaccggtgtcggtaac
ctcactctgcgttatgttcgcttcacgtccccgcaacatcatcgtgtcattctgattgtt
cccggacgcattgaaagctacatcaaatacccggaactggcctatgacttgttccattgt
ggttttgacgtggtgatcattgaccatcgtggtcagggacgttccgatcgcctgctggaa
gattcccaccgtgggcatgtggtggatttcaatgattacgtcgacgatctggaaacgctc
tacctgaaagagatcgtcagcggtcattaccggcagcgctatgcgctggcgcattcgatg
ggcggcgcgatcctcgcgctgtttctggcgcgtcagccacgggcgtttcatgccgtggcg
ctggcggcaccgatgtttggtattaccttgccgctgccgcctttcctcgcgcaccgtatt
cttgattgggcggagaaaatgcccgcattacgtgatggttatgccctgggcaccgggcgc
tggcgtgcccatccctttggcatcaaccagttgacccacagccgggaacgttatcagcgc
aatttgcggttttacgcggacgatccggcgattcgcgtcggcggccccacctatcattgg
gtgcgcgaaggggtgcaggccgggcgcagcatcatcagtcaggtgaataacatcaccaca
ccgatgctactgatgcaggccagcgaagatcgggtggtggataaccgctcgcaggatttg
ttttgtgaggcgatggcagcagcaggacatccctgcgagggtgtcacgccttatgtgatt
gagggcgcgcgccatgagatcttgtttgaaacagacgcgatgcgcgctcaggcgctaaac
gcggtggtggatttttttgcgcgccacgtttaa

DBGET integrated database retrieval system