KEGG   Pantoea sp. At-9b: Pat9b_0229Help
Entry
Pat9b_0229        CDS       T01386                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
pao  Pantoea sp. At-9b
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pat9b_0229
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Pat9b_0229
Enzymes [BR:pao01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Pat9b_0229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
277213..278517
Genome map
AA seq 434 aa AA seqDB search
MTTRAQQIKQLETTWRDARWQGITRPYSAQDVVNLRGSVNPACTLAERGAQKLWSLLHGE
SQKGYINSLGALTGGQAVQQAKAGIEAIYLSGWQVAADANLAGQMYPDQSLYPVNSVPAV
VERINQSFQRADQIQWASGMSPDVEGFIDYYLPIVADAEAGFGGVLNAFELMKSMIQAGA
AAVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMDVPTVLIARTDADAADL
ITSDCDEYDRAFITGERTAEGFFRTRAGIEQAISRGLAYAPYADVLWCETSTPDLALAQR
FADAIHARYPGKLLAYNCSPSFNWKKNLDDHTIARFQQALSEMGYRFQFITLAGIHSMWF
NMFDLAHAYAQGEGMRHYVEKVQQPEFAAREKGYTFSSHQQEVGTGYFDRITTVIQGGQS
SVTALTGSTEAAQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacgactcgtgcacaacaaatcaaacagctggaaaccacctggcgcgacgcgcgctgg
cagggcattacccgtccctatagcgcgcaggatgtggtgaatttacggggttcggtgaat
ccggcctgcaccttggccgaacgcggtgcgcaaaagctgtggtcgctgctgcatggcgaa
tcgcagaaaggttatatcaatagcctgggagccttgaccggtggtcaggcggtacagcag
gcgaaggcgggtattgaggcgatttacctctcgggctggcaggtggcggcggatgccaac
cttgccgggcaaatgtacccggaccagtcgctctatccggtgaactcggtaccggcggtg
gtggagcggatcaaccagagcttccagcgggccgatcagattcagtgggccagcgggatg
tcgccggacgtcgaagggttcattgattactacctgccgattgtggcggatgccgaagct
gggtttggcggggtactcaacgcgtttgagttgatgaagtcgatgatacaggccggtgcg
gcggcagtgcattttgaagatcagctggcggcagtgaagaaatgtggccatatgggcggc
aaagtgctggtgcccactcaggaggcgattcaaaaactggtggcggcacgactggcggcg
gatgtcatggatgtcccgacggtgctgattgcccgcaccgacgccgatgccgctgacctg
atcacctcggactgtgatgagtacgatcgcgcctttatcaccggcgaacgtaccgcggaa
gggttcttccgcacccgcgccgggatcgagcaggcaatcagtcgtggtctggcttacgcc
ccttacgcggatgtgctgtggtgcgaaacgtcaacgccggatctggcgctggcgcagcgc
tttgccgatgccatccacgcccgctaccccggcaaattgctggcctacaactgttcgccg
tcgtttaactggaagaaaaacctcgatgatcacaccatcgcccgcttccaacaggcgttg
agcgagatgggttaccgcttccagttcattaccctggcgggtattcacagcatgtggttc
aacatgttcgacctggcgcacgcttatgcgcagggcgaggggatgcgtcactacgtggag
aaagtgcagcagcccgaatttgcagcgcgtgagaagggctacaccttctcgtcccatcag
caggaggtgggtaccggctatttcgaccgcatcaccacggtcatccagggtggccagtcg
tcagtgaccgcgctgaccggttccactgaagccgcgcagttctga

DBGET integrated database retrieval system