KEGG   Pantoea sp. At-9b: Pat9b_0243Help
Entry
Pat9b_0243        CDS       T01386                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pao  Pantoea sp. At-9b
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Pat9b_0243
Enzymes [BR:pao01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Pat9b_0243
Exosome [BR:pao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pat9b_0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
297554..299737
Genome map
AA seq 727 aa AA seqDB search
MSELPDRQAINALFAGNYSDPFSLLGMHQTAEGLEVRALLPDASEVWVIETNTGRKCAQL
ECFDSRGFFSGVIPRRKNLFRYQLAVNWHGQQNLIDDAYRFGPLLEEMDAWLLAEGTHLR
PYETLGAHGMTLDGVSGTRFSVWAPNARRVSVVGEFNYWDGRRHPMRFRRELGIWELFVP
GAFNGQLYKFEIIDAFGHLRIKADPFAFEAQMRPQTASMICGLPPKTEMTPERKAANAFD
APISIYEVHLGSWRRHTENNFWLSYKELSEQLISYVKEMGFTHIELLPINEHPFDGSWGY
QPLGMYAPTRRFGTRDEFREFVASAHAAGINVLLDWVPGHFPSDDFGLAKFDGTELYEHS
DPREGYHQDWNTLIYNFGRREVSNYLSGNALYWLERFGIDGLRVDAVASMIYRDYSRAEG
EWIPNQYGGRDNLEAISFLRYTNRTLGRAAPGSITVAEESTDYPGVSRPPEAGGLGFWFK
WNLGWMHDTLDYMKHDPVHRRYHHQLMTFGMLYNYTENFVLPLSHDEVVHGKRSILDRMP
GDPWQKFANLRAYYGWMWAFPGKKLLFMGGEFAQGKEWNHDTSLDWHLLEGADNWHHGVQ
RLVRDLNHTYRHYSPLYQLDFDPQGFEWLVVDDHENSVFAFVRRDRAGNEVIVVSNFTPV
PRHHYRFGVNQAGRWQEVLNTDQHDYHGSDLRNHQVHTDDIPSHGRGQSLSLSLPPLATV
WLVREGE
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgtcagagcttcccgatcgccaggcgatcaatgccctgtttgcgggtaattattccgat
cccttttccctgctgggaatgcaccagaccgcagaaggtctggaggtccgggccttgctg
cccgacgcgtcagaggtgtgggtgattgaaaccaacaccgggcgtaaatgcgctcagttg
gaatgttttgactcacgcggcttcttcagtggcgtgatcccccgccgcaaaaacctgttt
cgctatcaactggcggttaactggcatggccagcagaatctgattgatgatgcctaccgt
ttcgggccgttgctggaggagatggatgcctggttgctggccgagggcacccatttacgt
ccgtatgaaacgttgggcgcgcatggcatgacccttgatggcgtcagcgggacgcgtttc
tccgtctgggcacccaatgcccgccgggtgtcggtggtgggggaatttaactattgggat
ggacgccgccatccgatgcgcttccgtcgtgagcttggcatctgggagttgtttgtcccc
ggagccttcaacggccagctgtacaaattcgaaatcattgatgcgttcggccatctgcgt
atcaaagccgatccctttgcctttgaagcgcagatgcgcccgcagaccgcctcaatgatc
tgtggcctgccaccgaaaaccgagatgacaccagagcgtaaagcggcgaatgcctttgat
gcgccgatatcgatttacgaagtgcatctcggttcctggcggcgacataccgagaacaac
ttctggctcagctacaaggaactgtcggagcagttgatctcgtatgtcaaagagatgggt
tttacccatattgagctgttgccgattaatgagcacccgtttgacggtagttgggggtat
cagccgctcggcatgtatgcgccgacccgtcgctttggcacccgcgatgagttccgcgaa
ttcgttgccagtgcgcatgcagccggtatcaacgtgctgctggattgggtaccgggccat
tttcccagcgatgacttcgggctggcgaaatttgatggcaccgagctgtatgaacacagc
gatccacgggaaggctaccatcaggactggaacacgctgatctacaactttggtcgccgt
gaagtgagtaattacctctccggcaatgcgctgtactggctggagcgtttcggtatcgat
gggctgcgcgtggatgcggtggcatcaatgatctaccgcgattacagccgggctgaaggg
gagtggatacccaatcaatacgggggccgcgataaccttgaggctatctctttcctgcgt
tacaccaaccgcacgctggggcgcgcagcgcctggcagcatcaccgtggcggaagaatca
accgactatcccggcgtctcgcgcccaccggaagcgggggggctgggcttctggttcaaa
tggaatctgggctggatgcacgacacgctggattacatgaaacacgatccggtgcatcgc
cgctaccatcatcagctgatgaccttcggcatgctctacaactacacggaaaacttcgta
ttgccgctgtcacatgacgaagtggtacacggcaaacgctcgattctcgaccgtatgccg
ggcgatccttggcagaaattcgccaacctgcgtgcctattacggttggatgtgggccttc
cccggcaagaaactgctgtttatgggcggtgaatttgcgcagggtaaagagtggaaccac
gacaccagcctcgactggcatctgctggaaggcgcggataactggcatcacggcgtacaa
cggctggtacgcgatctcaaccatacctaccgccactattcaccgctgtatcagctggat
ttcgacccgcaggggtttgaatggctggtggttgatgatcatgaaaactctgtctttgcc
tttgtgcggcgcgatcgcgcgggcaatgaggtgattgtggtcagcaacttcaccccggtg
ccgcgtcaccattaccgctttggcgtcaatcaggcggggcgctggcaagaagtgctgaat
accgaccagcatgactaccacggcagcgacctgcggaatcatcaggtacataccgatgac
atcccgagtcacggtcgggggcaatccctcagtctatccctgccgccgctggcgacggtt
tggttggtgcgggagggagaataa

DBGET integrated database retrieval system