KEGG   Pantoea sp. At-9b: Pat9b_0503Help
Entry
Pat9b_0503        CDS       T01386                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
pao  Pantoea sp. At-9b
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pat9b_0503
Enzymes [BR:pao01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Pat9b_0503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
586216..587049
Genome map
AA seq 277 aa AA seqDB search
MKLYARDTHLDLSFPHVMGILNVTPDSFSDGGKHNSLVDALTHTNEMVNAGATIIDVGGE
STRPGADEVSVEEELERVIPVVEAIAQRFEVWISVDTSKAEVIRESARVGAHIINDIRSL
SEPGAMQAAAETGLPVCLMHMQGEPRTMQQAPQYQNIVSEVDAYFTEQIARCVAAGIKKE
NLLLDPGFGFGKNLSHNYELLAELSHFHHFGMPLLVGMSRKSMIGQLLNVGPAQRLTGSL
TCAVIAAMQGAHIIRVHDVKETVEAMRVVEATRRAKG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgtacgcccgtgatacccatctcgatctctcgtttccccatgtgatgggcatt
ttaaatgtcacgccggactccttctccgatggcgggaagcacaattcattggtggatgcg
ctcacgcacaccaatgagatggttaatgcgggggcgaccattattgatgtgggtggcgaa
tcgacgcgcccgggagcggatgaggtcagtgttgaagaagagctggagcgcgttatcccg
gtggtggaagcgattgcgcagcgtttcgaggtatggatttcagtcgatacctcaaaagca
gaagtgatccgcgaatccgcgcgagtgggtgctcacatcattaatgacattcgctcgcta
tctgaacccggtgcaatgcaggctgcggcagagaccgggttaccggtgtgtctgatgcat
atgcagggggagccacgcaccatgcagcaggcaccgcagtatcaaaacatcgtcagcgaa
gtggatgcttacttcaccgaacagatcgcacgttgtgtcgccgcagggattaaaaaagag
aatctgctactcgaccccggctttggtttcggtaagaatctcagccacaactatgagctg
ctggctgaattgagccattttcaccatttcggcatgccgttattggtggggatgtcgcgt
aagtcgatgattggccagttgctgaatgtcggtccggcgcagcgtctgactggcagcctg
acgtgtgcggtgatcgccgccatgcagggcgcacacattattcgcgtgcacgacgtgaaa
gaaactgttgaagcgatgcgtgtggttgaagcgacacgcagagcaaaaggataa

DBGET integrated database retrieval system