KEGG   Pantoea sp. At-9b: Pat9b_0536Help
Entry
Pat9b_0536        CDS       T01386                                 

Definition
(GenBank) DNA-directed DNA polymerase
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00230  Purine metabolism
pao00240  Pyrimidine metabolism
pao01100  Metabolic pathways
pao03030  DNA replication
pao03430  Mismatch repair
pao03440  Homologous recombination
Module
pao_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pat9b_0536
   00240 Pyrimidine metabolism
    Pat9b_0536
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Pat9b_0536
   03430 Mismatch repair
    Pat9b_0536
   03440 Homologous recombination
    Pat9b_0536
Enzymes [BR:pao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pat9b_0536
DNA replication proteins [BR:pao03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pat9b_0536
DNA repair and recombination proteins [BR:pao03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Pat9b_0536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ADU67861
JGI: Pat9b_0536
UniProt: E6W7G3
Position
complement(623174..623632)
Genome map
AA seq 152 aa AA seqDB search
MKNATFYVMESDTASDGLSAIEALVCDLAEARWRDGKRILIACTDEQQANRLDEALWQRP
ANAFVPHNLAGEGPRYGAPVELAWPQRRGSSPRDLLISLLPQFADFATAFHEVIDFVPYE
ESQKQLARDRYKAYRSVGFQLNTATPPPPQTT
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgccaccttttatgtgatggagtccgatactgccagcgacggcctgagcgcc
atcgaagcgttggtgtgcgatctggccgaagcacgctggcgtgacggcaagcgcatcctg
attgcctgtaccgatgaacagcaggccaatcgtctggatgaagccttatggcagcgcccg
gcaaacgcctttgtgccgcataacctcgccggtgaaggcccgcgttatggcgcgccggtc
gagctggcctggccgcaacgacgtggcagttcaccgcgtgacttgctgatcagcctgctg
ccgcagttcgcagattttgctactgctttccatgaagtgatagacttcgttccttacgaa
gaatcccagaaacagctggcgcgtgaccgctataaagcgtatcgcagcgttggcttccaa
ttgaatacggcgacgccaccaccgccgcaaacgacatag

DBGET integrated database retrieval system