KEGG   Pantoea sp. At-9b: Pat9b_0578Help
Entry
Pat9b_0578        CDS       T01386                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
pao  Pantoea sp. At-9b
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:pao00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pao00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:pao03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:pao03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pao03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
669626..670036
Genome map
AA seq 136 aa AA seqDB search
MTSRRDWLLQQMGITQYQLRRPRVLQGEIAVRLTPDTRLVLVAEHAPALHEPLVRDVLRT
LNLQPAQVMTLTPEQLQMLPEQVDCAGWLLGVDSSHPFNGVTFATAAFNELISSGAAKRA
LWQQMCNHDSHLFSHP
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaggcgcgactggcttttacagcaaatggggattacgcagtatcagctgcgg
cgtccgcgcgtattgcagggagagattgccgtcaggctcaccccagatacccggctggta
ttggtggcggaacacgccccggcgctgcatgaaccgctggtgcgtgatgtgcttcgcacc
ctgaacctgcaacccgctcaagtgatgacgctcacgccagaacagctccagatgctcccc
gagcaggtggactgtgcgggctggttgctcggggtcgacagctcgcatccttttaatggc
gtcacttttgcgaccgccgctttcaatgaattaatcagtagcggtgcggcaaaacgcgcc
ctctggcaacagatgtgtaatcatgacagccatctctttagtcatccctga

DBGET integrated database retrieval system