KEGG   Pantoea sp. At-9b: Pat9b_0578Help
Entry
Pat9b_0578        CDS       T01386                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
pao  Pantoea sp. At-9b
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pat9b_0578
   00240 Pyrimidine metabolism
    Pat9b_0578
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Pat9b_0578
   03430 Mismatch repair
    Pat9b_0578
   03440 Homologous recombination
    Pat9b_0578
Enzymes [BR:pao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Pat9b_0578
DNA replication proteins [BR:pao03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Pat9b_0578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
669626..670036
Genome map
AA seq 136 aa AA seqDB search
MTSRRDWLLQQMGITQYQLRRPRVLQGEIAVRLTPDTRLVLVAEHAPALHEPLVRDVLRT
LNLQPAQVMTLTPEQLQMLPEQVDCAGWLLGVDSSHPFNGVTFATAAFNELISSGAAKRA
LWQQMCNHDSHLFSHP
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaaggcgcgactggcttttacagcaaatggggattacgcagtatcagctgcgg
cgtccgcgcgtattgcagggagagattgccgtcaggctcaccccagatacccggctggta
ttggtggcggaacacgccccggcgctgcatgaaccgctggtgcgtgatgtgcttcgcacc
ctgaacctgcaacccgctcaagtgatgacgctcacgccagaacagctccagatgctcccc
gagcaggtggactgtgcgggctggttgctcggggtcgacagctcgcatccttttaatggc
gtcacttttgcgaccgccgctttcaatgaattaatcagtagcggtgcggcaaaacgcgcc
ctctggcaacagatgtgtaatcatgacagccatctctttagtcatccctga

DBGET integrated database retrieval system