KEGG   Pantoea sp. At-9b: Pat9b_0811Help
Entry
Pat9b_0811        CDS       T01386                                 

Definition
acireductone dioxygenase (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
pao  Pantoea sp. At-9b
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pao00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
940656..941198
Genome map
AA seq 180 aa AA seqDB search
MSALTIFTDTEASQPVWHSTDAAAIRERLNAKGVRFERWEADRDLGANPDSDTVINAYQH
AIDRLVAEKGYQSWDVLSMRADNPQKEVLRSKFLNEHTHSEDEVRFFVEGSGLFCLHLDG
QVYQILCEKQDLISVPAGTPHWFDMGSEPHFTAIRIFDNQEGWIANFTGDSIADAYPRLA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcactgaccatttttaccgataccgaagccagccagccggtgtggcacagtacc
gatgcagcagcgattcgcgagcgtctgaacgccaaaggcgtgcgttttgaacgctgggaa
gcggatcgcgatctgggtgccaacccggattccgacacggtgatcaacgcgtatcagcat
gcgatcgatcgcctggtagccgagaaaggttaccagagctgggatgtattgagcatgcgt
gccgacaacccgcagaaagaagtgctgcgcagcaagtttctcaacgaacatacccatagc
gaagatgaagtgcgtttctttgtcgagggttcaggtctgttctgcctgcatcttgatggt
caggtgtatcagattctgtgcgaaaaacaggacctgatttcggtgccggcaggcacgccg
cattggtttgatatgggttctgagccgcactttaccgccatccgtattttcgacaatcag
gaaggttggattgcgaacttcacgggcgacagcattgcggatgcctatccgcgtctggcc
tga

DBGET integrated database retrieval system