KEGG   Pantoea sp. At-9b: Pat9b_0871Help
Entry
Pat9b_0871        CDS       T01386                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
pao  Pantoea sp. At-9b
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:pao00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:pao00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:pao00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1001692..1004760)
Genome map
AA seq 1022 aa AA seqDB search
MTSVSVSLSEILARRDWENPVITSLNRLDAHPPFASWRDEQAARDDRPSPSRRSLNGQWT
FSYFAQPEAVPQSWLLQDLPDAGSLPVPANWQLHGYDAPIYTNVQYPIPVNPPWVPSNNP
TGCYSLTFNVDATWLQQGQTRIIFDGVNSAFFLWCNGQWIGYSQDSRLPAEFDLSSVLQA
GSNRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQLADVQIETVLSPEYIRAD
LRVSITIQQLKPCRLRLRLWQGETLIGEHEQAPGSAIIDERGHYPERALLVLPVNQPKLW
SAETPHLYRAVVSLLDDQGNLLEAEAYDVGFRRVAIENGLLCLNGQPLLIRGVNRHEHHP
EKGQVVDEASMRRDIELMKRHNFNAVRCAHYPNHPLWYRLCDEYGLYVVDEANIETHGMQ
PMNRLSDDPRWFAAYSERVTRMVQRDRNHPCIIIWSLGNESGHGSTHDALYRWVKSSDPS
RPVQYEGGGANSAATDIVCPMYARVDQDQPFPAVPKWSLKKWIGLPGETRPLILCEYAHA
MGNSFGGFAKYWQAFRQFPRLQGGFVWDWVDQSLTRYDSQGEAWQAYGGDFGDTPNDRQF
CMNGLVFADRTPHPALFEAQRAQQFFTFTADAQDPWRFTVSSDYLFRHSDNEVLRWSVEQ
EGDVVAQGELALDIAPRASQTFTLPQVEGLQGNCWLNLAVHQPHATRWSEADARVAWHQW
PLPAAQPTNSPGQTEAAPQVESNHDLIAVCLPHQRWHFSRRSGELVQWFVNDEETLLTPL
QECFIRAPIDNDIGTSEAANVDPNAWVERWKRAGYDQLEPQLMAMEIDSLKHSVLIETRH
QWHAAGQVIFTSRKRYQIRGNGEVSLDIDVEQTAGLPPPARIGLRAQLAHAPQQVSWLGL
GPHENYPDRQLAAQFSRWRQPLSSMRTEYVFPGENGLRSGTRQLDTGSWQVSGDFAFSLS
QHSLEQLRATSHRHLLQPEAGCWLHLDGFHMGVGGDDSWSPSVSPEFLLSQQRWHFSLTL
RQ
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atgacatctgtctctgtttccctcagcgaaatcctggcgcgacgcgactgggaaaacccg
gtaattaccagcctgaaccgactcgatgcgcatcccccctttgccagttggcgcgatgag
caggcggcacgtgacgatcgtccttcgccgtcccgtcgcagcctgaatggccaatggacg
ttcagctattttgcccagccggaagcagtgccacaaagctggctgttacaggatctgcca
gatgccgggagcttaccagtacctgcaaactggcaactacacggctatgatgccccgatc
tacactaacgtgcagtaccctatcccggttaacccaccgtgggttccgagcaacaatcca
accggatgttactcgctcacattcaatgttgacgctacctggctgcaacagggccagacg
cgcattatctttgatggcgtgaactccgccttctttctgtggtgcaacggtcaatggatt
ggttattcgcaggacagccgcttacctgccgaattcgatctcagtagcgtgttgcaggca
ggcagtaaccgtctggcggtcatggtgctgcgctggagcgatggcagttacctggaagat
caggatatgtggcgcatgagcggtatttttcgcgatgtctccctgctgcataaacccacg
acacaactggctgacgtgcaaattgaaacggtgctcagcccggaatatatccgtgccgac
ttgcgggtcagcataacgatccagcaactcaaaccctgtcgtctgcgtctacgcctgtgg
caaggggaaacgctgatcggcgaacacgaacaagcccccggcagcgccattattgacgaa
cgcggtcactacccggaacgcgcattgctggtattgccggtcaaccaacccaaactgtgg
agcgccgaaacaccccatctgtaccgtgcggtggtttctctgctcgatgatcaaggcaac
ctgctggaggcggaagcttacgatgtcggtttccgtcgggtagcgattgaaaatggcctg
ctgtgtctgaatggtcagccgctgctgattcgcggtgtgaaccgccacgaacatcatccg
gaaaagggccaggtggtggatgaggccagcatgcggcgcgatattgagttgatgaaacgc
cataacttcaacgcagtgcgctgtgcgcattatccaaatcatccattgtggtatcgcctg
tgcgatgagtatggtttgtacgtggtggatgaggcgaatatcgaaacccacggcatgcag
ccgatgaatcgcctttctgatgacccgcgctggtttgccgcttacagcgaacgcgtcacc
cgcatggtgcagcgcgatcgcaatcacccctgcattattatctggtcattgggcaatgag
tctggtcatggcagcacccacgatgcattgtaccgatgggtgaaaagcagcgatcccagt
cgcccggtgcaatatgaaggcggcggagccaatagcgccgcaaccgatattgtttgcccg
atgtatgcccgcgtcgatcaggatcagcccttcccggcggtgcccaaatggtcactgaag
aagtggatcggcctgcccggcgaaacccgcccgctgatcttgtgcgaatatgctcatgcg
atgggcaacagctttggcggcttcgccaaatactggcaggctttccgccagtttccacgt
ttacagggcggtttcgtctgggattgggtggatcaaagtctgacgcgttatgactcgcaa
ggcgaggcatggcaagcctatggtggggacttcggcgacacgccgaatgaccgccagttc
tgcatgaacggcctggtgtttgccgatcgcacaccacatccggcactgttcgaagctcag
cgggcgcagcagtttttcacgttcaccgcggatgcacaggacccctggcggtttaccgtc
agcagcgattacctgtttcgccatagcgataacgaagtgctgcgctggtcggttgaacaa
gagggcgacgttgtggcccagggtgaactggcgctcgatatcgcaccccgcgccagtcag
acatttacgctgccacaggttgaaggattacaaggcaactgctggcttaatctggcagtg
caccaaccgcacgcgacccgctggtcagaagccgatgcacgtgtcgcctggcatcaatgg
ccgctgcctgctgcgcaaccgacaaattcaccggggcagacagaagcggccccgcaggtt
gagtcgaatcatgatttgatcgctgtttgtctgccacaccagcgctggcatttttcccgt
cgcagcggcgagctggtgcagtggttcgtgaatgacgaggaaaccctgctgacgccgctc
caggagtgtttcatccgcgcaccgattgataacgacatcggcaccagcgaagccgccaac
gttgatccgaatgcctgggtcgagcgctggaaacgcgcgggttatgatcagcttgagccg
cagttaatggcgatggaaattgacagcctgaagcatagcgtgctgattgaaacgcggcat
cagtggcatgctgccgggcaggtgatctttaccagccgcaagcgttatcagattcgcggt
aatggtgaagtctccctcgatatcgatgtcgaacagacggcaggcttgccaccaccggca
cgtattggcttgcgcgcgcagctggctcatgccccgcagcaggtcagttggttgggactg
gggccacatgaaaactatcccgaccgccaactggccgcacaattctcccgctggcggcag
ccgctaagcagcatgcgcaccgaatatgtttttccgggggaaaatggtctgcgtagcggg
acacgccagcttgataccggaagctggcaggtaagcggtgatttcgccttctcgctgagt
cagcacagcctggagcaactgcgcgccacctcgcatcgccacctgttgcagccagaagcg
ggttgctggctgcatctcgatggcttccatatgggggtcggcggggatgattcctggagt
ccgagcgtcagcccggagtttttgctttctcagcagcgctggcacttctccctgacgctg
cgtcagtaa

DBGET integrated database retrieval system