KEGG   Pantoea sp. At-9b: Pat9b_0932Help
Entry
Pat9b_0932        CDS       T01386                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00010  Glycolysis / Gluconeogenesis
pao00071  Fatty acid degradation
pao00350  Tyrosine metabolism
pao00625  Chloroalkane and chloroalkene degradation
pao00626  Naphthalene degradation
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01120  Microbial metabolism in diverse environments
pao01130  Biosynthesis of antibiotics
pao01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pat9b_0932
  Lipid metabolism
   00071 Fatty acid degradation
    Pat9b_0932
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pat9b_0932
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pat9b_0932
   00626 Naphthalene degradation
    Pat9b_0932
Enzymes [BR:pao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pat9b_0932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 AlaDh_PNT_C adh_short 2-Hacid_dh_C 3HCDH_N TrkA_N
Motif
Other DBs
NCBI-ProteinID: ADU68256
JGI: Pat9b_0932
UniProt: E6W7Z4
Position
1065869..1066909
Genome map
AA seq 346 aa AA seqDB search
MTMKIKTTMKAAVVKSFGEPLVIEDVPVPSVGPGQILVKIAATGVCHTDLHAAEGDWPIK
PTPPFIPGHEGVGQIVAVGEGVKHLKLGDRVGVPWLYSACGHCEYCLDSWETLCLSQQNA
GYSVNGSFAEYCLADANYVGVLPDNIEFNEIAPILCAGVTVYKGLKMTDTKPGDWVVISG
IGGLGHMAVQYAVAMGLNVAAVDIDDEKLEFAKRLGASVVANAKNVDPAKFFHESFGGAH
GVLVTAVSPKAFEQALGTMRRGGTMVLNGLPPGKFDLSIFDMVLDGITVRGSIVGTRKDL
QEALDFAGRHKVKANVAVEPLVNINDIFARMHAGKIEGRIVVDMSL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgactatgaagatcaaaaccacgatgaaagcggcagttgtgaaatcattcggtgagcca
ttagtgattgaggacgttccggttccttcggtagggccgggccagattctggtgaaaatc
gctgccaccggtgtttgtcataccgacctgcacgctgcggaaggtgactggccaatcaag
ccgaccccgccgtttattcctggccatgaaggggtgggacagatcgtggcagtgggtgaa
ggggtgaaacatctcaagttgggcgatcgcgttggtgtgccttggctctactcggcttgt
ggtcactgtgaatattgtctcgatagctgggaaacgctctgcctgtcacagcagaatgcc
ggttattcggtcaatggcagctttgcggaatattgtcttgccgatgctaactacgtcggg
gtgttgccggataatatcgagttcaatgaaatcgcaccgatcctttgtgccggtgtcacg
gtgtacaaagggctgaagatgaccgataccaaaccgggtgactgggtggtgatctccggt
atcggcggcctggggcatatggcggtgcagtacgcggtagctatggggctgaatgtggcc
gccgtggatattgatgacgagaagctggagtttgcgaaacgtctgggtgccagcgtggtg
gctaatgctaagaatgttgatccggcgaaattcttccatgaaagcttcggtggcgcgcac
ggtgtgctggtaacagcggtttcaccgaaagcctttgagcaggcattgggcaccatgcgt
cgtggcggtactatggtgctgaatggtctgccgccgggcaaatttgacctgtcgatcttt
gatatggtgctggatggtattacggtgcgtggttcgattgtcggcacccgtaaagatttg
caggaagcgctcgacttcgccggtcgtcacaaagtgaaagctaatgtggcggtggagccg
ttggtgaacatcaacgatatttttgcgcggatgcatgccggtaaaattgaaggccgcatt
gtcgtcgatatgtcgctgtaa

DBGET integrated database retrieval system