KEGG   Pantoea sp. At-9b: Pat9b_0932Help
Entry
Pat9b_0932        CDS       T01386                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
pao  Pantoea sp. At-9b
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Pat9b_0932
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pat9b_0932
  Lipid metabolism
   00071 Fatty acid degradation
    Pat9b_0932
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pat9b_0932
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pat9b_0932
   00626 Naphthalene degradation
    Pat9b_0932
Enzymes [BR:pao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pat9b_0932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1065869..1066909
Genome map
AA seq 346 aa AA seqDB search
MTMKIKTTMKAAVVKSFGEPLVIEDVPVPSVGPGQILVKIAATGVCHTDLHAAEGDWPIK
PTPPFIPGHEGVGQIVAVGEGVKHLKLGDRVGVPWLYSACGHCEYCLDSWETLCLSQQNA
GYSVNGSFAEYCLADANYVGVLPDNIEFNEIAPILCAGVTVYKGLKMTDTKPGDWVVISG
IGGLGHMAVQYAVAMGLNVAAVDIDDEKLEFAKRLGASVVANAKNVDPAKFFHESFGGAH
GVLVTAVSPKAFEQALGTMRRGGTMVLNGLPPGKFDLSIFDMVLDGITVRGSIVGTRKDL
QEALDFAGRHKVKANVAVEPLVNINDIFARMHAGKIEGRIVVDMSL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgactatgaagatcaaaaccacgatgaaagcggcagttgtgaaatcattcggtgagcca
ttagtgattgaggacgttccggttccttcggtagggccgggccagattctggtgaaaatc
gctgccaccggtgtttgtcataccgacctgcacgctgcggaaggtgactggccaatcaag
ccgaccccgccgtttattcctggccatgaaggggtgggacagatcgtggcagtgggtgaa
ggggtgaaacatctcaagttgggcgatcgcgttggtgtgccttggctctactcggcttgt
ggtcactgtgaatattgtctcgatagctgggaaacgctctgcctgtcacagcagaatgcc
ggttattcggtcaatggcagctttgcggaatattgtcttgccgatgctaactacgtcggg
gtgttgccggataatatcgagttcaatgaaatcgcaccgatcctttgtgccggtgtcacg
gtgtacaaagggctgaagatgaccgataccaaaccgggtgactgggtggtgatctccggt
atcggcggcctggggcatatggcggtgcagtacgcggtagctatggggctgaatgtggcc
gccgtggatattgatgacgagaagctggagtttgcgaaacgtctgggtgccagcgtggtg
gctaatgctaagaatgttgatccggcgaaattcttccatgaaagcttcggtggcgcgcac
ggtgtgctggtaacagcggtttcaccgaaagcctttgagcaggcattgggcaccatgcgt
cgtggcggtactatggtgctgaatggtctgccgccgggcaaatttgacctgtcgatcttt
gatatggtgctggatggtattacggtgcgtggttcgattgtcggcacccgtaaagatttg
caggaagcgctcgacttcgccggtcgtcacaaagtgaaagctaatgtggcggtggagccg
ttggtgaacatcaacgatatttttgcgcggatgcatgccggtaaaattgaaggccgcatt
gtcgtcgatatgtcgctgtaa

DBGET integrated database retrieval system