KEGG   Pantoea sp. At-9b: Pat9b_0980Help
Entry
Pat9b_0980        CDS       T01386                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pao  Pantoea sp. At-9b
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:pao00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pat9b_0980
DNA repair and recombination proteins [BR:pao03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Pat9b_0980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1113669..1114274
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMESLRCLPGVGPKSAQRMAFHLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDICTICANPRRQQNGQICVVESPADIHAIEQTGQFAGRYFVLMGHLSPLDGIGP
QDIGLDRLEQRLEQETLQEVILATNPTVEGEATANYIAELCSQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKIKF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccactgcttgaatctttgatggagtcgctgcgttgtctgccgggtgtt
ggcccgaagtcggcgcagcgaatggcatttcatctgttgcagcgcgatcgcagcggtggc
atgcgtctggcgcaggcgttaacccgcgccatgtcggaaatcggccattgcgctgattgc
cgtaccttcaccgagcaggacatctgcaccatctgcgccaacccgcgtcgtcagcaaaac
ggccagatttgcgtggtggaaagcccggcggatattcacgctattgagcagactggccag
ttcgcgggtcgctactttgtgctgatgggtcacctgtcgccactcgatggcatcggcccg
caggatatcgggctggatcgtctggaacagcgtctggaacaggaaaccttgcaggaagtg
atcctcgccaccaatcccacggtggaaggtgaagccacggccaactatatcgccgagctg
tgcagtcagtacggcgtggacgccagccgcattgcccacggcgtgccggtgggcggtgag
ctggagatggtcgatggcacgacgctgtcgcactcgctggccggacgtcacaagattaaa
ttttaa

DBGET integrated database retrieval system