KEGG   Pantoea sp. At-9b: Pat9b_1001Help
Entry
Pat9b_1001        CDS       T01386                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
pao  Pantoea sp. At-9b
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Pat9b_1001
Enzymes [BR:pao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Pat9b_1001
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Pat9b_1001
Lipid biosynthesis proteins [BR:pao01004]
 Fatty acid synthase
  Component type
   Pat9b_1001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1137680..1138336)
Genome map
AA seq 218 aa AA seqDB search
MLSLTDGLSKMMNFNNVFRWHYSFLLLLLLLVSRLAAADTLLVLGDSLSAGYRMSANVAW
PYLLDKEWQQQPKVINASISGDTAGQGLARLPALLKQHQPRWVLIELGGNDGLRGFPPQN
IAQDLSKIIDDVKAANAQPLLMQIRLPANYGRRYTQAFSAIYPQLAQQYNIPLVPFFMEQ
VYLKPEWMQQDGIHPNPDAQPFIASVMAKELAPLVKHD
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgctctccctgaccgacggacttagtaagatgatgaacttcaacaatgttttccgctgg
cattattccttcctgttgttattgcttctgctggtgtcacgtcttgctgcggccgatacg
ctgctggtactgggcgatagcctgagtgccggttaccgcatgtccgccaacgttgcctgg
ccctatctgttggataaagagtggcaacaacagcccaaagttatcaacgccagcatcagt
ggcgataccgccggacagggcctggcgcgtttaccggcgttattaaaacaacatcaaccg
cgctgggtgttaatcgaattgggcggtaacgatggtctgcgtggcttccctccgcaaaat
atcgcccaggacctgagcaaaattatcgacgatgtgaaagcagcaaacgcgcagccgctg
ctgatgcaaattcgtttaccggcaaattatggacgtcgttatacgcaggcgtttagcgcg
atttatccgcagctggcacaacagtacaacattcctctggtgcccttctttatggagcag
gtgtatctgaaaccggagtggatgcagcaggatggtattcacccgaatccggatgcacag
ccttttatcgccagtgtgatggcgaaagaactggctccgctagtaaagcatgattaa

DBGET integrated database retrieval system