KEGG   Pantoea sp. At-9b: Pat9b_1116Help
Entry
Pat9b_1116        CDS       T01386                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00020  Citrate cycle (TCA cycle)
pao00310  Lysine degradation
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01120  Microbial metabolism in diverse environments
pao01130  Biosynthesis of antibiotics
pao01200  Carbon metabolism
Module
pao_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pao_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pat9b_1116
  Amino acid metabolism
   00310 Lysine degradation
    Pat9b_1116
Enzymes [BR:pao01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Pat9b_1116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: ADU68438
JGI: Pat9b_1116
UniProt: E6WC22
Position
1257434..1258657
Genome map
AA seq 407 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVSRDEVIVEIETDKVVLEVPAAADGVLDAV
LEDEGATVTSRQILGRLKEGNSSGKETTAKVESKESTPAQRQTASLEEESNDALSPAIRR
LIAEHDLDASQIKGSGVGGRLTREDVEKHLAKKTEAKAAPAAQPAAAAAPTAVANRSEKR
VPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDAFEKRHGVRLGFMSFY
IKAVVEALKRFPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLKDVDALSMADIEKK
IKELAVKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAV
NGQVVVLPMMYLALSYDHRLIDGRESVGYLVAVKEMLEDPARLLLDV
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgtagatattctcgttcccgatttgcctgaatccgtagcggacgcaacggta
gcaacctggcataaaaaacccggcgacgcggtcagtcgcgatgaagtgattgtcgaaatc
gaaaccgacaaagtggtactggaagtgccggctgctgccgacggcgttctggatgcggtg
ctggaagatgaaggcgcaaccgtgacctctcgtcagatccttggccgtctgaaagaaggc
aacagcagcgggaaagagactactgcgaaagtagagagcaaggagtctacgccagcacag
cgtcagactgcgtctctggaagaagagagcaacgacgcgctcagcccggcgattcgccgc
ctgatcgcggaacatgacctcgacgccagccagatcaaaggcagcggcgtgggcggtcga
ctcacgcgtgaagatgtcgaaaaacatctggcgaagaaaaccgaagcgaaagccgctccg
gctgcgcagcctgctgctgccgctgcgccgacggcggttgcgaatcgcagcgagaaacgc
gtgccgatgacgcgtctgcgtaagcgtgtagctgaacgtctgctggaagcgaaaaacagc
accgcgatgctgaccaccttcaacgaagtcaacatgaagccgatcatggatctgcgtaag
cagtacggcgatgccttcgagaagcgtcacggtgtgcgtctgggctttatgtccttctac
atcaaagccgtggttgaagccctgaagcgcttcccggaagtgaacgcgtcaatcgacggt
gaagatgtggtgtaccacaactatttcgacgtcagcatcgcggtatccaccccgcgtggt
ctggtgacgccagtgctgaaagatgttgatgcgctgagcatggctgacatcgagaagaaa
attaaagagctggcggtaaaaggccgtgacggcaagctgaccgtggaagagctgaccggc
ggtaacttcaccatcaccaacggtggtgtgttcggttcgctgatgtccacgccgatcatc
aacccgccgcagagcgcaattctgggtatgcacgctatcaaagatcgtccgatggcggtg
aatggccaggttgtggtgttgccgatgatgtatctggcgctctcttatgatcaccgcctg
attgatggccgcgagtctgtcggctatctggtggcagtgaaagagatgctggaagatccg
gcacgtctgctgctggacgtctga

DBGET integrated database retrieval system