KEGG   Pantoea sp. At-9b: Pat9b_1117Help
Entry
Pat9b_1117        CDS       T01386                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00020  Citrate cycle (TCA cycle)
pao00640  Propanoate metabolism
pao00660  C5-Branched dibasic acid metabolism
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01120  Microbial metabolism in diverse environments
pao01130  Biosynthesis of antibiotics
pao01200  Carbon metabolism
Module
pao_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pao_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pat9b_1117
   00640 Propanoate metabolism
    Pat9b_1117
   00660 C5-Branched dibasic acid metabolism
    Pat9b_1117
Enzymes [BR:pao01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pat9b_1117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADU68439
JGI: Pat9b_1117
UniProt: E6WC23
Position
1258733..1259899
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVKSKEEIRAFAEHWLGKRLVTYQTDAEGQPVNQILVEAATDIDQELYLGAVVDRASRR
VVFMASTEGGVEIEKVAEETPHLIHKMALDPLAGPQPYQGRELAFKLGLTGKQVSQFTKI
FMGLATMFLERDLALVEINPLVVTKQGDLVCLDGKLGADGNALFRQPELREMRDPSQEDP
REAHATQWELNYVALEGNIGCMVNGAGLAMGTMDIVKHHGGQPANFLDVGGGATKERVTE
AFKIILSDDAVKAVFVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTDAAQRVVAAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacacgaataccaggcgaaacagctgtttgcacggtatggtatgccggcaccg
acgggctacgcctgtactacgccacgtgaagcagaagaagccgcctcaaaaattggcgct
ggcccgtgggtagtgaaatgtcaggttcatgccggtggccgcggtaaagcgggcggtgtg
aaagtggttaagagcaaagaagagatccgcgcttttgctgaacactggctgggcaaacgt
ctggtgacctatcaaactgacgccgaaggtcagccggtaaaccagattctggtggaagcc
gcgactgacatcgatcaggaactctatctgggtgcggtagttgaccgtgccagccgtcgt
gtggtcttcatggcctcgaccgaaggtggtgttgagatcgagaaagtggcggaagagacc
ccgcacctgatccacaaaatggcgcttgatccgttagcgggtccgcagccgtatcagggc
cgcgagctggcgttcaaactgggcctgaccggtaagcaagtcagccagttcactaaaatc
tttatgggtctggcgaccatgttcctcgagcgcgatctggcgctggtggagatcaacccg
ctggttgtcaccaagcagggcgatctggtgtgcctcgatggcaaactgggtgccgacggc
aacgccctgttccgtcagccggaactgcgtgaaatgcgtgacccgagccaggaagacccg
cgtgaagcgcatgcgacccagtgggaactgaactacgtcgcactggaaggcaacattggc
tgtatggtcaacggtgcgggtctggcgatgggtacgatggacatcgtgaaacaccacggt
ggtcagcctgctaacttccttgatgtcggcggcggcgcaaccaaagagcgcgtcactgaa
gccttcaaaatcatcctgtctgacgatgcagtgaaagcggtattcgttaacatcttcggc
ggcatcgtgcgttgcgacctgatcgcagacggcatcatcggtgcagtggcagaagtgggt
gtcaacgtaccggtggtggtacgtctggaaggtaacaacgccgagctgggcgctaagaaa
ctggcggacagcggtctgaacatcattgcagcaaccagcctgacagacgcggcacagcgt
gttgttgctgctgcggagggtaaataa

DBGET integrated database retrieval system