KEGG   Pantoea sp. At-9b: Pat9b_1228Help
Entry
Pat9b_1228        CDS       T01386                                 

Definition
agmatinase
Orthology
K12255  
guanidinobutyrase [EC:3.5.3.7]
Organism
pao  Pantoea sp. At-9b
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Pat9b_1228
Enzymes [BR:pao01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.7  guanidinobutyrase
     Pat9b_1228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1377216..1378175)
Genome map
AA seq 319 aa AA seqDB search
MTHFPQPQGGNEMPRFAGRGTMMRLPASESPADLDVAFIGIPLDIGTSQRSGTRYGPRAI
RADSVMIRPYNMATGAAPFDSLRVGDLGDVPINTYSLLKSVDIIEEFYSDLNQWPLIPLT
LGGDHTLTLPILRALAKKHGPMGLIHVDAHTDTNDEMFGEKIAHGTTFRRAVEEGLLDCQ
RVVQIGQRAQGYAADDFQWGVDQGFQLIPAEQCWHRSLTPLMAEVRTRIGSGPVYLSYDI
DSFDPAWAPGTGTPEVGGLTSMQGLEIVRGCRGLNLVGGDLVEVSPPYDQSGMTSQLAAN
ILYEMLCVLPGVRYTEKKQ
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacccattttccccaaccgcagggcggcaatgagatgccgcgtttcgccggacgcggc
accatgatgcgtttaccggccagtgagtcccccgccgatctggatgtggcgtttatcggt
atcccgctggatatcggcacctcacagcgcagcggcacccgctacgggccgcgcgccatc
cgcgccgattcggtgatgatccgtccttataatatggcgaccggggcagcgccgtttgat
tcgctgcgcgtcggcgatctcggcgatgtgccgatcaatacctacagcctgctgaaatcg
gtcgatatcattgaagaattttacagcgatctaaaccaatggccgctgattccgctgacg
ctgggcggtgaccacactctgacgctgccgattctgcgtgcgctggcaaaaaaacacggc
ccgatggggctgatccacgtggatgcccataccgacaccaatgatgagatgtttggtgaa
aaaattgcccacggcaccacgtttcgccgggcggtagaagaaggcttgctggattgtcag
cgcgtggtgcagattgggcaacgtgcgcagggctacgccgcagacgactttcaatggggg
gtcgatcagggcttccagctgatccccgccgagcagtgctggcatcgctcgctgacgccg
ttgatggccgaggtgcgcacgcggatcggtagcggcccggtgtacctttcttacgatatc
gacagctttgatcccgcctgggctcccggcaccggtacgccggaagtgggaggactgacc
tcgatgcaggggctggagatcgtgcgtggctgtcgcggtttgaatctggtgggtggcgat
ctggtggaagtgtcaccgccgtatgaccaaagcggcatgacctcacagctggcggccaat
atcctttatgagatgctgtgcgtgttgcccggcgtccgttacacagagaagaagcaatga

DBGET integrated database retrieval system