KEGG   Pantoea sp. At-9b: Pat9b_1497Help
Entry
Pat9b_1497        CDS       T01386                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pao  Pantoea sp. At-9b
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pao00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pao00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1670108..1671151
Genome map
AA seq 347 aa AA seqDB search
MTMNNPGPLMLDVESYELDAEEREILQHPLVGGLILFARNYHDPAQLAELVRQIRAASHS
RLVIAVDQEGGRVQRFREGFTLLPAMQSFAALHDLSTAGELAQQAGWQMAAEMIALDIDI
SFAPVLDIGHISAAIGDRSFHADPQIALQVARRFIAGMHEAGMKTTGKHFPGHGAVSADS
HKETPRDPRDAATLRQHDMAIFQQLIDERALDAVMPAHVIYTEVDPLPASGSPYWLKTVL
REELGFDGVIFSDDLSMEGAAVMGSYAERAQQSLNAGCDMILVCNHRQGAISVLDNLIPI
GATRVSQLYHQGRFTRDTLQASTRWQQNQRQLSELQHRWLAHKASGR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgaataaccccggaccactgatgcttgacgtcgaaagctacgagcttgacgcc
gaggagcgggaaattttgcaacatccgctggtgggcgggctgattctgtttgcccgcaat
tatcatgacccggcgcaactggccgagctggtgcggcagatccgcgcggcatcgcatagc
cgactggtgatcgccgtcgatcaggaaggcgggcgcgtacagcgtttccgtgagggtttc
accttgctaccggcgatgcagtcattcgcggcactgcacgatctgtccactgccggagaa
ctggcgcagcaggctggctggcaaatggcggcagagatgattgcgctggatatcgacatc
agcttcgctccggtgctggatattggccatatcagtgccgcaattggcgatcgttccttc
catgccgatccgcaaatcgcgctgcaagtcgcgcgtcgctttattgcgggcatgcatgaa
gcgggcatgaaaaccaccggcaaacatttccccggccatggcgcggtgagtgccgattcc
cacaaagagacgccacgcgatccgcgtgatgctgcgaccctgcgccagcatgatatggcg
atcttccagcaactgattgacgagcgcgcgttagatgcggtgatgcctgcccacgttatc
tatactgaggtggacccgttgcctgccagcggttcgccttactggctgaaaaccgtgttg
cgggaagagttgggctttgacggggtgattttctccgatgatttgtcgatggaaggggct
gcggtgatgggcagctatgccgaacgcgcacaacagtcgctgaacgccggatgtgacatg
attctggtgtgtaaccatcgtcagggtgccatcagcgtgctggataatttgatcccgatc
ggggcgacacgggtgtcgcagttataccatcagggacgattcacgcgagacacgctacag
gccagcacgcgctggcagcaaaatcagcgccagctcagtgagctgcaacaccgctggctg
gcacataaagcgtcgggcagataa

DBGET integrated database retrieval system