KEGG   Pantoea sp. At-9b: Pat9b_1549Help
Entry
Pat9b_1549        CDS       T01386                                 

Definition
FGGY-like carbohydrate kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pao  Pantoea sp. At-9b
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Pat9b_1549
Enzymes [BR:pao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Pat9b_1549
Exosome [BR:pao04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pat9b_1549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1721148..1722635
Genome map
AA seq 495 aa AA seqDB search
MAGPLILAIDEGTTNAKAIAVDRHGTVVARGSQPLTLNHPQPGLAEQDPIAIWQAVQQAV
SDCLAQCQGEPVAAVAISNQRESVLIWQRRDGQPLTPLVSWQDRRSEAFCRDLRQAGKAP
RITGLTGLAVDPMFPAAKLTGMLAAVPQGLERARAGELCIGTVDSWLSWQLTGGECFVTD
HANAARTQLYSLHRGDWDDELLALFHIPRAALPAIVPSASAQGVVAIADIPGLAPGTPLL
ARIGDSHAALQAQRSGSEEVVKATYGTGSSLMMSMATPLLTENGLSTTVAWHDGTLRFAF
EGNITHTGSGAAWLGRMIGINDPRELTRLAQSTDSNQGIYFVPALSGLGAPWWDLQARGM
LCGLTDAATPAVLARVALESITCQIADVFFAMEQASGVQLPALCVDGSATENSWLMQLQA
DVLQRPLRRAPTPEVSALGAALLAGRSLGWWQQGSDMAALQGGSVVYPREELAQSMHDHY
QGWLDAVARCRYQPC
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atggcaggtccgttgatactggcgattgatgaaggcaccaccaacgccaaagcgatcgcc
gtggatcgccatggcacggtggtggcgcgcggtagccagccgttgaccctgaaccatcca
cagccgggactggcggagcaggaccccatcgccatctggcaggcggtgcaacaggcggtc
agcgactgtctggcgcaatgccagggggagccggtggcggcggtggcgatcagcaaccag
cgcgaatcggtactgatctggcagcggcgcgacggacagccgttaacgccgctggtcagc
tggcaggatcgccgttcggaagcgttctgtcgtgatttacgtcaggcggggaaagcgccg
cgtatcaccggtctgaccgggttggcggtcgatccgatgtttcctgccgccaaactgacc
ggcatgctggcggcggtaccgcaagggctggaacgcgcccgcgcgggcgaattatgtatt
ggcacggtcgatagctggcttagctggcaactgaccggcggcgaatgtttcgtcaccgat
cacgccaatgccgcgcgtacccaattgtatagtctgcaccgtggtgactgggatgacgag
ttgttggcgctgtttcatattccgcgtgccgcattgccagcaattgtaccgtcggccagc
gcgcagggcgtggtggcgatcgctgatattcccggtctggctccgggtacgccgttgctg
gcgcgcatcggtgattcccacgctgcgcttcaggcacaacgcagcggcagcgaagaagtg
gtgaaagccacctatggcaccggctcctcgttgatgatgtcgatggcgacgccgttactg
accgaaaacggcctcagcactaccgtagcctggcatgacggcaccttacgttttgcgttt
gaaggcaacatcacccataccggttctggtgcggcctggctggggcggatgatcggcatc
aatgatccacgtgagttgacccggctggcgcaaagtaccgacagcaatcagggcatttac
tttgtaccggcgctgtcgggactgggtgcgccctggtgggatctgcaagcgcgtggcatg
ctgtgcggcttaaccgatgcggctacgccggcggtgctggcacgcgtggcgctcgaatcc
atcacctgccagattgccgatgtgtttttcgccatggaacaggcgagtggcgtgcagcta
ccggcgttgtgcgtcgacggcagtgccacggaaaacagctggctgatgcagttgcaggcc
gatgtcttacagcgtccgctccgacgagctccaacgccggaagtctcggcgctgggggct
gcgctgctggccggacgctcgctgggttggtggcagcagggcagtgacatggcggcgtta
cagggaggcagcgtggtctatccgcgtgaggagctggcgcaaagcatgcacgaccattat
cagggatggctggacgccgtggcacgctgtcgttaccagccttgctaa

DBGET integrated database retrieval system