KEGG   Pantoea sp. At-9b: Pat9b_1608Help
Entry
Pat9b_1608        CDS       T01386                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
pao  Pantoea sp. At-9b
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:pao00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Pat9b_1608
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Pat9b_1608
Enzymes [BR:pao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Pat9b_1608
Two-component system [BR:pao02022]
 CheA family
  CheA-CheYBV
   Pat9b_1608
Bacterial motility proteins [BR:pao02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Pat9b_1608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1788641..1789690
Genome map
AA seq 349 aa AA seqDB search
MSKITVMCVDDSALMRQLMTEIINSHPDMEMVATAPDPLVARDLIKQYNPQVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEITLRALELGAVDFVTKPQLGIREGMLAYS
QMIADKIRAAARAKLHVRAATAVPATLKAVPLLSSEKLIAIGSSTGGTEAIRHVLQPLPA
TSPALLITQHMPPGFTRSFAERLNKLCQITVKEAEDGERILPGHAYIAPGAMHMELARSG
ANYVVKINDAPPVNRHKPSVDVLFRSVAVNAGRNAVGVILTGMGNDGAAGMLEMHRAGAW
TIAQDEASCVVFGMPREAIALGGASEVVDLGHISQHMLAKISAGQALRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatcaccgtgatgtgcgtggatgactctgcgctgatgcggcagttgatgacc
gaaatcatcaacagccatcctgatatggagatggttgctacggcaccggacccgctggtg
gcgcgtgacctaatcaagcagtacaacccgcaagtgctgacgctggatgtggaaatgccg
cgcatggacggcctcgattttctcgaaaagctcatgcgtctgcgcccgatgccggtggta
atggtgtcatcgctgaccgggaaaggatcggagatcaccctgcgggcgctggagttgggg
gcggtggattttgtcaccaaaccgcagctcggtatccgtgaaggtatgctggcttacagc
cagatgatcgccgataaaattcgcgccgccgcacgcgcaaaattgcatgtccgggcagcc
acggcggtcccggcgacgttgaaagcggtgccgttgctgagtagtgaaaagctgattgcg
attggttcatccaccggtggcacggaggcgatccgccatgtgttgcagccgctgccggcg
accagcccggcactgctgatcacccagcatatgccaccagggtttacccgctcatttgct
gagcgcctgaataagctgtgccagatcaccgtgaaagaagcggaagacggcgagcgtatt
ctgcccggtcatgcgtacattgcgcctggtgcgatgcatatggaactggcacgaagtggt
gccaactacgtggtgaaaattaacgacgcgccgcccgtcaatcgtcataagccgtcggtg
gacgtgctgttccgatcggtggcggtgaacgccggacgaaatgcagtgggtgtcattctg
accgggatggggaacgacggcgcggccgggatgctggaaatgcatcgcgccggtgcctgg
accatcgcccaggatgaagccagctgcgtggtatttggcatgccgcgcgaggcaattgca
ctcggcggtgccagcgaagtggtcgatttgggccacatcagccagcacatgctggcgaaa
attagcgccggacaggcattgcgaatttaa

DBGET integrated database retrieval system