KEGG   Pantoea sp. At-9b: Pat9b_1653Help
Entry
Pat9b_1653        CDS       T01386                                 

Definition
peroxiredoxin (EC:1.11.1.15)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
pao  Pantoea sp. At-9b
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:pao00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:pao00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1832035..1832577
Genome map
AA seq 180 aa AA seqDB search
MSIYQTELVTLDGEKTTLEQWQGKVLLVVNVASKCGLTPQYEQLEALQKAWQSQGFSVLG
FPCNQFLEQEPGSSEEIKTFCSTTYGVTFPMFEKTDVNGPARHALYSALVAAQPEALRPE
GSGFYERMVSKGRAPKAPGDILWNFEKFLINKQGEVVARFAPDMTPDDATLVARIKQALA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttatcaaacagaactggttacgcttgacggtgaaaaaaccaccctggaacag
tggcagggtaaggtgctgctggtggtgaatgtcgcctcaaaatgtggcctcacgccgcaa
tacgagcaactggaagcgctgcaaaaggcgtggcagtcacaaggcttcagcgtccttggt
tttccgtgtaatcagtttctggagcaagagccgggtagcagcgaagagatcaaaaccttc
tgtagcaccacctacggcgtcacgttccccatgtttgaaaagaccgatgtgaatggtccg
gcgcgccacgcactgtacagcgccctggtggcggcccagccggaagcgctgcgtccggaa
ggcagcggtttttatgagcgtatggtgagcaaaggccgtgcgccgaaagcaccgggcgat
atcctgtggaatttcgaaaaattcctgatcaataagcaaggtgaagtggttgcgcgtttc
gcgccggatatgacgccggacgatgccaccttggttgcccgtattaaacaggccctggcg
taa

DBGET integrated database retrieval system