KEGG   Pantoea sp. At-9b: Pat9b_1795Help
Entry
Pat9b_1795        CDS       T01386                                 

Definition
(GenBank) phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00010  Glycolysis / Gluconeogenesis
pao00030  Pentose phosphate pathway
pao00051  Fructose and mannose metabolism
pao00052  Galactose metabolism
pao00680  Methane metabolism
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01120  Microbial metabolism in diverse environments
pao01130  Biosynthesis of antibiotics
pao01200  Carbon metabolism
pao01230  Biosynthesis of amino acids
pao03018  RNA degradation
Module
pao_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pat9b_1795
   00030 Pentose phosphate pathway
    Pat9b_1795
   00051 Fructose and mannose metabolism
    Pat9b_1795
   00052 Galactose metabolism
    Pat9b_1795
  Energy metabolism
   00680 Methane metabolism
    Pat9b_1795
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Pat9b_1795
Enzymes [BR:pao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pat9b_1795
Protein phosphatases and associated proteins [BR:pao01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Pat9b_1795
Messenger RNA biogenesis [BR:pao03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Pat9b_1795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADU69111
JGI: Pat9b_1795
UniProt: E6WEH1
Position
1992420..1993400
Genome map
AA seq 326 aa AA seqDB search
MRIGMVISGGDVTGINNFIFQISRLTQADMVLFNGGIPGLLENKHQEVSQRDLVDYAIAA
IPIMQSGRPTRKLIRPEYEAIAKQLKSLRIDVLIMAGGDGSLQFLHILSEFGVNCFGVGM
TIDNDVFGSDYTIGFSTACEQVLKEVAKLRNTGRGLPGRVFMVELLGGYCGELTLQSAIK
SNADFALIPECQIATQELAQRITARLEQQNSVVILCSEAYTREYSPGFQGAIDTLIKQLE
PLIGVRVRKTIIGYGLRNGEPTCEEIYQGTIMASEVARCIQSGMRNKAVIINGSNKPIPI
DLISMKKRLVDTEGHHYKLAKQLHIL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggcatggtgatcagcggtggtgatgttaccggcataaataactttatcttt
caaatttcccgcttaacgcaggcggatatggtgttatttaatggtggcattcccggtttg
ctggaaaataaacaccaggaagtatcccagcgtgatttggtggattatgccattgcggcg
atcccgataatgcagtcaggaagaccaacgcgaaaattaattcgcccggaatatgaagcc
atagccaaacaacttaagtcgctgcgcattgatgtgttaattatggcgggtggcgatgga
tcgttgcaattcctccatattctgagtgaatttggcgtcaattgtttcggcgtgggtatg
accatcgataacgacgtatttggcagcgattataccattggtttttccaccgcctgtgag
caagtgctgaaggaagtggcgaaattacgtaataccggccgtggcttgccaggtcgtgtc
tttatggtggagctgttgggggggtattgcggcgaattaaccctgcaatcggcgattaaa
tccaacgcagattttgccttgatccccgagtgccagattgccacacaggaattggcgcag
cgcatcaccgcacggctggagcagcagaacagcgtggtgatcctgtgttcggaagcctac
acccgtgagtattcgccgggatttcagggggcgatcgataccttaattaaacaactggaa
ccgctgatcggggtacgtgtccgtaaaaccatcatcggctatggcctgcgtaatggtgaa
ccgacctgtgaagaaatttatcagggcaccattatggccagcgaagtggcgcgttgtatt
cagtcgggaatgcgcaataaagccgtcattattaatggcagcaataaaccgatacccatt
gatttaataagcatgaaaaaacgcctggttgacaccgaagggcatcattacaaactcgct
aaacaactgcatattctgtga

DBGET integrated database retrieval system