KEGG   Pantoea sp. At-9b: Pat9b_1795Help
Entry
Pat9b_1795        CDS       T01386                                 

Definition
phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
pao  Pantoea sp. At-9b
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pat9b_1795
   01230 Biosynthesis of amino acids
    Pat9b_1795
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pat9b_1795
   00030 Pentose phosphate pathway
    Pat9b_1795
   00051 Fructose and mannose metabolism
    Pat9b_1795
   00052 Galactose metabolism
    Pat9b_1795
  Energy metabolism
   00680 Methane metabolism
    Pat9b_1795
Enzymes [BR:pao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Pat9b_1795
Protein phosphatases and associated proteins [BR:pao01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Pat9b_1795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1992420..1993400
Genome map
AA seq 326 aa AA seqDB search
MRIGMVISGGDVTGINNFIFQISRLTQADMVLFNGGIPGLLENKHQEVSQRDLVDYAIAA
IPIMQSGRPTRKLIRPEYEAIAKQLKSLRIDVLIMAGGDGSLQFLHILSEFGVNCFGVGM
TIDNDVFGSDYTIGFSTACEQVLKEVAKLRNTGRGLPGRVFMVELLGGYCGELTLQSAIK
SNADFALIPECQIATQELAQRITARLEQQNSVVILCSEAYTREYSPGFQGAIDTLIKQLE
PLIGVRVRKTIIGYGLRNGEPTCEEIYQGTIMASEVARCIQSGMRNKAVIINGSNKPIPI
DLISMKKRLVDTEGHHYKLAKQLHIL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgagaattggcatggtgatcagcggtggtgatgttaccggcataaataactttatcttt
caaatttcccgcttaacgcaggcggatatggtgttatttaatggtggcattcccggtttg
ctggaaaataaacaccaggaagtatcccagcgtgatttggtggattatgccattgcggcg
atcccgataatgcagtcaggaagaccaacgcgaaaattaattcgcccggaatatgaagcc
atagccaaacaacttaagtcgctgcgcattgatgtgttaattatggcgggtggcgatgga
tcgttgcaattcctccatattctgagtgaatttggcgtcaattgtttcggcgtgggtatg
accatcgataacgacgtatttggcagcgattataccattggtttttccaccgcctgtgag
caagtgctgaaggaagtggcgaaattacgtaataccggccgtggcttgccaggtcgtgtc
tttatggtggagctgttgggggggtattgcggcgaattaaccctgcaatcggcgattaaa
tccaacgcagattttgccttgatccccgagtgccagattgccacacaggaattggcgcag
cgcatcaccgcacggctggagcagcagaacagcgtggtgatcctgtgttcggaagcctac
acccgtgagtattcgccgggatttcagggggcgatcgataccttaattaaacaactggaa
ccgctgatcggggtacgtgtccgtaaaaccatcatcggctatggcctgcgtaatggtgaa
ccgacctgtgaagaaatttatcagggcaccattatggccagcgaagtggcgcgttgtatt
cagtcgggaatgcgcaataaagccgtcattattaatggcagcaataaaccgatacccatt
gatttaataagcatgaaaaaacgcctggttgacaccgaagggcatcattacaaactcgct
aaacaactgcatattctgtga

DBGET integrated database retrieval system