KEGG   Pantoea sp. At-9b: Pat9b_2091Help
Entry
Pat9b_2091        CDS       T01386                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00260  Glycine, serine and threonine metabolism
pao00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01130  Biosynthesis of antibiotics
pao01230  Biosynthesis of amino acids
Module
pao_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pat9b_2091
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pat9b_2091
Enzymes [BR:pao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pat9b_2091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADU69404
JGI: Pat9b_2091
UniProt: E6WDU8
Position
2311655..2312458
Genome map
AA seq 267 aa AA seqDB search
MERYNQLFKRLSANHEGAFVPFVTLGDPSPEMSLKIIDALVAGGADALELGIPFSDPLAD
GPTIQNATLRAFAAGTTTAQCFEILAAVRQKYPDLPIGLLMYANLVFSKGIDNFYAQCAA
VGVDSVLVADVPVEESAPFRQAAMRHNVAPIFICPPNADDDLLREIASHGRGYTYLLSRA
GVTGSENRAHVPLQHLINKLREYHAAPPLQGFGISEPGQVKEAVSAGAAGAISGSAIVKI
IERHQNQPETLLSELQAFVSNLKAATR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttacaatcagctgtttaaacgtctgtcggcgaaccatgaaggcgcgttcgtt
cctttcgtgaccctcggcgatccgtcacctgagatgtcgctgaagattattgatgcgctg
gtcgcaggcggtgctgatgcgctggaattaggcatcccattctccgatccgctggccgat
ggcccaaccatccagaacgcgaccttacgcgctttcgcggccgggaccaccaccgcgcaa
tgctttgaaatccttgccgctgtgcgtcagaaataccctgacctgccgattggcctgctg
atgtacgctaatctggtgtttagcaaagggatcgataatttttatgcgcagtgcgctgcg
gtgggtgtcgattcagtgctggtggctgatgtgccggtggaagaatccgccccgttccgc
caggccgcgatgcgccacaatgtggcaccgatctttatctgcccgccgaatgcggatgat
gacctgctgcgcgaaatcgcgtcgcatggccgtggttatacctatctgctgtcgcgcgcc
ggggtgaccggttcagaaaaccgcgcccatgtgccgttgcagcatctgatcaataaactg
cgcgagtaccatgctgctccgccgttgcagggctttggtatctccgagccgggccaggta
aaagaagccgtcagcgccggtgctgccggtgccatttccggttctgcgattgtgaaaatt
atcgaacgccatcaaaaccaaccggagacgctgctgagcgagctgcaagcctttgtcagc
aacctgaaggccgcgacccgttaa

DBGET integrated database retrieval system