KEGG   Pantoea sp. At-9b: Pat9b_2091Help
Entry
Pat9b_2091        CDS       T01386                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pao  Pantoea sp. At-9b
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pat9b_2091
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pat9b_2091
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pat9b_2091
Enzymes [BR:pao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pat9b_2091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2311655..2312458
Genome map
AA seq 267 aa AA seqDB search
MERYNQLFKRLSANHEGAFVPFVTLGDPSPEMSLKIIDALVAGGADALELGIPFSDPLAD
GPTIQNATLRAFAAGTTTAQCFEILAAVRQKYPDLPIGLLMYANLVFSKGIDNFYAQCAA
VGVDSVLVADVPVEESAPFRQAAMRHNVAPIFICPPNADDDLLREIASHGRGYTYLLSRA
GVTGSENRAHVPLQHLINKLREYHAAPPLQGFGISEPGQVKEAVSAGAAGAISGSAIVKI
IERHQNQPETLLSELQAFVSNLKAATR
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttacaatcagctgtttaaacgtctgtcggcgaaccatgaaggcgcgttcgtt
cctttcgtgaccctcggcgatccgtcacctgagatgtcgctgaagattattgatgcgctg
gtcgcaggcggtgctgatgcgctggaattaggcatcccattctccgatccgctggccgat
ggcccaaccatccagaacgcgaccttacgcgctttcgcggccgggaccaccaccgcgcaa
tgctttgaaatccttgccgctgtgcgtcagaaataccctgacctgccgattggcctgctg
atgtacgctaatctggtgtttagcaaagggatcgataatttttatgcgcagtgcgctgcg
gtgggtgtcgattcagtgctggtggctgatgtgccggtggaagaatccgccccgttccgc
caggccgcgatgcgccacaatgtggcaccgatctttatctgcccgccgaatgcggatgat
gacctgctgcgcgaaatcgcgtcgcatggccgtggttatacctatctgctgtcgcgcgcc
ggggtgaccggttcagaaaaccgcgcccatgtgccgttgcagcatctgatcaataaactg
cgcgagtaccatgctgctccgccgttgcagggctttggtatctccgagccgggccaggta
aaagaagccgtcagcgccggtgctgccggtgccatttccggttctgcgattgtgaaaatt
atcgaacgccatcaaaaccaaccggagacgctgctgagcgagctgcaagcctttgtcagc
aacctgaaggccgcgacccgttaa

DBGET integrated database retrieval system