KEGG   Pantoea sp. At-9b: Pat9b_2178Help
Entry
Pat9b_2178        CDS       T01386                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
pao  Pantoea sp. At-9b
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Pat9b_2178
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pat9b_2178
   00620 Pyruvate metabolism
    Pat9b_2178
   00650 Butanoate metabolism
    Pat9b_2178
  Lipid metabolism
   00071 Fatty acid degradation
    Pat9b_2178
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pat9b_2178
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pat9b_2178
   00626 Naphthalene degradation
    Pat9b_2178
Enzymes [BR:pao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pat9b_2178
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Pat9b_2178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2382978..2385665
Genome map
AA seq 895 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYANFSQEQVDAIFRAAALAAADARIPLAKMAVAESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGVLDTDDTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDIIGWIDTPSVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRAVASILMSKTF
DNGVICASEQSVIVVDSVYDAVRERFASHGGYLLQGKELKAVQDIILKNGALNAAIVGQP
APKIAEMAGITVPSNTKILIGEVKLVDESEPFAHEKLSPTLAMYRAKDFEDAVSKAEKLV
AMGGIGHTSCLYTDQDNQRERVHFFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVATDGAK
RAFIVTDRFLFNNGYADQVTRVLKSHGIETEVFFEVEADPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKARMIAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPRSLCAFGGLDAVTHSLE
AYVSVLANEYSDGQALQALKLLKENLPASYKEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANALLICNVIRYNANDNPTKQTAFSQYDRPQARRRYAEVAD
HLGLSAEGDRTAQKIEKLLAWLEEMKTQLGIPTSIREAGVQEADFLAKVDKLADDAFDDQ
CTGANPRYPLIAELKQIMLDTFYGREFVEATDEVADAVDLQPVKVVKVEKKTKKA
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atggccgtaactaatgtcgccgaacttaatgcactggtagaacgtgttaaaaaggcacag
cgtgaatacgccaactttagtcaggaacaagttgatgctatcttccgtgctgccgccctc
gccgcagcagatgcgcgaattcctctggctaagatggctgttgccgaatcaggcatgggc
atcgtcgaagataaagtcatcaaaaaccattttgcttcagaatatatctacaacgcatat
aaagatgaaaaaacctgcggcgtgctcgacactgacgacaccttcgggaccatcactatc
gcagaacctatcggcctgatttgcggtatcgttccaaccactaacccgacttctaccgcc
atcttcaaagcattaattagcctgaaaacacgtaacggtattatcttttcaccgcatcca
cgtgcgaaagatgcgaccaacaaagccgcagatatcgtgttgcaggcagcaatcgccgct
ggcgcaccgaaagacatcatcggctggattgataccccgtcggtggaactgtcgaatcaa
ctgatgcatcacccggatattaacctgattctggcaaccggtggtccgggcatggtgaaa
gcggcgtacagctccggtaaacctgcgattggtgttggtgccggtaataccccggtggtg
gtggatgaaacagccgatatcaaacgtgccgtcgcgtctatcctgatgtccaaaaccttc
gataatggcgtgatctgtgcttctgagcagtcagtgattgtggttgattccgtctatgac
gccgttcgcgaacgtttcgccagccacggtggttatctgttgcagggtaaagagctgaaa
gccgtgcaggatatcatcctgaaaaatggtgcgctgaatgctgccattgttggccagcct
gcacctaaaattgcagaaatggccggtatcaccgtcccatctaacaccaagatcctgatt
ggcgaagtcaaactggttgatgagtcagaaccgtttgcccatgaaaaattgtcgccgaca
ctggcaatgtatcgcgccaaagatttcgaagatgccgtgagtaaagcagaaaaactggtc
gccatgggcggtatcggccacacctcttgcctgtacaccgaccaggataaccagcgtgaa
cgcgtgcacttctttggcgacaagatgaaaacagcgcgtattctgatcaacaccccggcc
tcacaggggggtatcggcgacctgtataacttcaaactggctccgtcactgacactcggt
tgtggttcatggggcggcaactccatttctgaaaacgtgggacctaaacatctcatcaac
aagaaaaccgtggccaagcgagctgaaaatatgttgtggcataaacttccgaagtccatc
tacttccgtcgcggttctctgccaattgcactcgaagaagtggcaacggatggtgccaaa
cgtgccttcatcgtgactgaccgcttcctgttcaataacggttatgctgaccaggtcact
cgcgtactgaaatcacacggtatcgagactgaagtgttcttcgaagttgaagctgacccg
acgctgagtatcgtgcgtaaaggcgcagagcagatgaacagcttcaaacctgacgtgatt
atcgccctcggcggtggttcaccgatggatgcggcaaaaatcatgtgggtgatgtacgaa
catccggaaacccatttcgaagaactggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggtgtcaaagcacgcatgatcgccatcaccaccacttccggt
accggctctgaagttacaccgttcgcggtggtcaccgatgacgctaccggtcagaaatac
ccgctggctgactatgcactgaccccggatatggcgattgtcgatgctaacctggtgatg
gatatgccacgttcactctgcgccttcggaggtctggatgcggtaacccactcgctggaa
gcttacgtttccgttcttgccaatgaatactccgacggtcaggcactccaggcactgaaa
ttgctgaaagaaaacctgccagccagttataaagaaggtgcgaaaaacccggtagcccgt
gaacgtgtgcataatgcggcaaccattgcgggtatcgcctttgctaacgccttccttggt
gtatgtcactccatggcgcacaaactgggttctgagttccatatcccacatggtctggcg
aacgccctgctgatttgtaacgtcattcgctacaacgccaatgacaacccaaccaagcag
actgcttttagccagtatgaccgcccgcaggcacgtcgtcgttacgccgaagtggctgac
caccttggtctgagcgctgaaggcgaccgtaccgcgcagaaaattgaaaaactgctggcg
tggctggaagagatgaaaactcagctgggtattccgacctccattcgtgaagccggggtg
caggaagccgatttcctcgcgaaagtggataaactggctgacgatgccttcgatgaccag
tgtaccggtgctaacccacgttatccgctgattgctgaactgaaacaaatcatgctggat
accttctacggtcgtgaatttgtcgaagcaacagacgaagtggcagatgcggttgacctg
caaccggtgaaagtcgtcaaagtcgagaaaaagacgaaaaaagcctga

DBGET integrated database retrieval system