KEGG   Pantoea sp. At-9b: Pat9b_2183Help
Entry
Pat9b_2183        CDS       T01386                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00040  Pentose and glucuronate interconversions
pao00052  Galactose metabolism
pao00500  Starch and sucrose metabolism
pao00520  Amino sugar and nucleotide sugar metabolism
pao01100  Metabolic pathways
pao01130  Biosynthesis of antibiotics
Module
pao_M00362  Nucleotide sugar biosynthesis, prokaryotes
pao_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pat9b_2183
   00052 Galactose metabolism
    Pat9b_2183
   00500 Starch and sucrose metabolism
    Pat9b_2183
   00520 Amino sugar and nucleotide sugar metabolism
    Pat9b_2183
Enzymes [BR:pao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pat9b_2183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADU69495
JGI: Pat9b_2183
UniProt: E6WF74
Position
complement(2389650..2390558)
Genome map
AA seq 302 aa AA seqDB search
MSAFKSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLV
THSSKNAIENHFDTSFELESMLEKRVKRQLLDEIQSICPPHVTIMQVRQGIAKGLGHAVM
CAHPLVGDEPVAVILPDVIIDEYESDPTKDNLAEMLARYEESGRSQIMVEPVADVTAYGV
VDCKGADLAPGESAPMVGVVEKPKAAEAPSNLAVVGRYVLSADIWPLLAKTPPGAGGEVQ
LTDSIAMLMEKETVEAYHLKGVSHDCGNKLGYMQAFVEYGVRHPVLGKDFTQWLEGAVGN
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctttaagtcaaaagtaaaaaaagcggtaatccctgtagctggcctcggtacg
cgtatgctgcctgccaccaaagctatcccgaaagaaatgttgccgctggttgataagccg
ttgatccagtatgtcgtgaacgagtgtatcgctgctggcatcaatgaaatcgtgctggtc
acccattcctctaaaaacgccatcgagaaccactttgataccagttttgagctggagtcg
atgctggaaaaacgtgttaagcgtcagctgctggatgaaatccagtctatttgcccgccg
catgtgaccatcatgcaggttcgtcagggtatcgccaaaggtctgggtcacgcggtgatg
tgtgcacacccgctggtgggtgatgagccggttgcggttattctgccggacgtgatcatc
gacgagtacgaatctgatccgacgaaagacaacctggctgaaatgctggcacgttacgaa
gaaagtggccgcagccagattatggtggagccggttgctgacgttactgcttacggtgtg
gttgactgtaaaggtgccgatctggcgccgggcgaaagtgcaccgatggttggcgtggtt
gaaaaaccgaaagccgctgaagcgccgtcaaacctggcagtcgtgggtcgttatgtgttg
tctgctgacatttggccactgctggctaaaacccctccgggtgcgggtggtgaagttcag
ctgactgactccatcgccatgctgatggaaaaagagaccgttgaagcttatcacctgaaa
ggtgtgagccatgattgcggtaacaagctgggttatatgcaggcttttgttgagtacggt
gttcgccatccggttctgggtaaagatttcacccaatggcttgaaggcgctgtaggaaac
aaaaagtaa

DBGET integrated database retrieval system