KEGG   Pantoea sp. At-9b: Pat9b_2197Help
Entry
Pat9b_2197        CDS       T01386                                 

Definition
(GenBank) Nicotinamidase
  KO
K08281  nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00760  Nicotinate and nicotinamide metabolism
pao01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Pat9b_2197
Enzymes [BR:pao01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Pat9b_2197
    3.5.1.-  
     Pat9b_2197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Isochorismatase
Motif
Other DBs
NCBI-ProteinID: ADU69508
JGI: Pat9b_2197
UniProt: E6WF87
Position
2403969..2404577
Genome map
AA seq 202 aa AA seqDB search
MKRALIIIDIQNDFCPGGPMAVREGDLTVAVANRYAREFRARGECVVALQDWHPNNHGSF
ASVSGEPVYTLGELNGLAQIWWPDHGIQGSAGADFHPDLDRSLIDAVFHKGEDVDVDSYS
AFFDNGHRRKTELDSWLRERDISHLVVLGLATDYCVKYSVLDALELGYQVEVVEEGCRGV
NLNPEDSDIAIEQMRNQGAVII
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgggcattgataatcatcgatatacagaacgatttttgccccggcggccccatg
gccgtgcgtgaaggtgacctaaccgttgccgttgcgaatcgctacgcacgtgagtttcgt
gcccggggcgagtgtgtggtggcattacaggactggcatccgaataatcatggcagcttt
gcctcggtatcaggcgaacccgtctatacccttggcgagctgaacggcctggcacagatt
tggtggccggatcacggcattcagggatcggctggtgctgattttcaccctgacctggat
cgctcgctgatcgatgccgtgttccataaaggcgaagatgttgacgttgacagctacagc
gcctttttcgataacggccaccgccgcaaaacggagctggatagctggttgcgtgagcgt
gatatcagccatctggtggtgctgggcctggcgactgactactgcgtcaaatatagcgtg
ctggatgcgctggaactgggctaccaggttgaggtagtggaagaaggctgccgtggggtc
aatctcaaccctgaagatagcgacattgccattgagcaaatgcgtaaccagggtgcggtc
attatctga

DBGET integrated database retrieval system