KEGG   Pantoea sp. At-9b: Pat9b_2310Help
Entry
Pat9b_2310        CDS       T01386                                 

Definition
(GenBank) Holliday junction DNA helicase RuvA
  KO
K03550  holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pao  Pantoea sp. At-9b
Pathway
pao03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pao00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Pat9b_2310
Enzymes [BR:pao01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Pat9b_2310
DNA repair and recombination proteins [BR:pao03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Pat9b_2310
    RecFOR pathway proteins
     Pat9b_2310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuvA_N HHH_5 RuvA_C HHH IMS_HHH HHH_2 Transposase_20 SepF TctA
Motif
Other DBs
NCBI-ProteinID: ADU69612
JGI: Pat9b_2310
UniProt: E6WA47
Position
complement(2514993..2515607)
Genome map
AA seq 204 aa AA seqDB search
MIGRLRGNILEKQPPLVLIEAHGVGYEVHMPMTCFYELPELNQEAIIFTQFVVREDAQLL
FGFNSKQERALFRELIKVNGVGPKLALAILSGMSAQQFVTAVEKEEIAVLVKLPGVGKKT
AERLVVEMKDRFKGMHGDLFGGDNAFTLTTPSAAPENNDAEAEAVAALVALGYKPQEASR
MVSKIGRPDADCETLIREALRAAI
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
gtgattggtcgtctacgaggcaatattctggaaaaacagccgccgctggtgttgattgaa
gcacacggtgtcggatacgaagtgcatatgccaatgacctgcttctatgagctgcctgaa
ctcaatcaggaagccatcatcttcacccagttcgtggtgcgtgaagatgcacagctgctg
ttcggctttaacagcaagcaggagcgggcgctgttccgtgagctgattaaggtcaatggt
gtggggccaaaactggcgctggcgatcctttccggcatgtcggcgcagcagttcgtcacg
gcggtagaaaaagaagagattgcggtgctggtgaagctgccgggcgtcgggaaaaaaacc
gccgagcgtctggtggtagagatgaaggaccgcttcaaaggcatgcatggcgacctgttt
ggcggggataatgcctttaccctgaccacgccatctgcggcaccggagaacaacgacgct
gaagcagaagcggttgcggcgctggtagcgctggggtataaaccgcaggaagccagccgc
atggtcagcaaaattggccgacctgatgcagactgcgaaaccctgatccgtgaagccctg
cgcgcagccatttga

DBGET integrated database retrieval system