KEGG   Pantoea sp. At-9b: Pat9b_2349Help
Entry
Pat9b_2349        CDS       T01386                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00900  Terpenoid backbone biosynthesis
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01130  Biosynthesis of antibiotics
Module
pao_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Pat9b_2349
Enzymes [BR:pao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Pat9b_2349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADU69651
JGI: Pat9b_2349
UniProt: E6WBG6
Position
2553462..2554319
Genome map
AA seq 285 aa AA seqDB search
MITTWPAPAKLNLFLYITGRRPDGYHNLQTLFQFLDYGDTLNITPDSSGDIRLLTPLDDV
PNEQNLIVRAARALMCAAAERGTLPAQAGATIALEKRLPMGGGLGGGSSDAATVLVALNH
LWQTGLSVDELATMGVRLGADVPVFVRGHAAFAEGVGEQLQPAEPDEKWYLVAHPGVSIA
TPTIFGDPELTRDSPKRSLDELLQRPFHNDCESVARKRFREVDELVSWLLEYAPSRLTGT
GACVFAEFNTESEARQVLELAPGWIRGFVARGLNVSPLQRTLSGI
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgatcaccacctggccagcccccgcgaagctgaacttatttttgtacatcactggccgt
cgtcccgacggctatcataatctgcaaaccctgtttcagtttctggactacggcgatacg
ctgaacatcaccccggatagcagtggcgacattcgtcttttgacgccgctggacgatgtt
cccaatgaacagaacctgattgtgcgtgccgcgcgtgcgctaatgtgcgcagcagcggaa
cgcggcaccttgccagcgcaggctggcgcgacgattgccctggaaaaacgtctgccgatg
ggcggaggtttaggtgggggttcgtcggatgccgccaccgtgttagtggccttaaaccat
ctgtggcaaaccggattgagcgtggatgaactggccaccatgggtgtgcgactgggtgcc
gatgttccggtctttgtgcgcggtcatgccgcttttgcggaaggcgtgggtgaacaatta
caacccgctgagccggatgaaaaatggtatctggttgcgcatccgggggtcagtatcgcg
acaccgacgatttttggtgatcccgaactgacgcgtgattcaccgaaacgttcacttgat
gaacttttgcagcgccctttccacaatgattgtgagtctgtggcaagaaaacgttttcgt
gaggttgatgagctggtttcctggctgctagaatacgcgccgtcgcgcctgactgggacc
ggggcctgtgtgtttgctgaatttaacaccgaatccgaagctcgtcaggtgctggagctt
gccccgggatggatacgaggatttgtggcgcgcgggctgaatgtctcgccgttgcagcgt
actctttccgggatttaa

DBGET integrated database retrieval system