KEGG   Pantoea sp. At-9b: Pat9b_2367Help
Entry
Pat9b_2367        CDS       T01386                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
pao  Pantoea sp. At-9b
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:pao00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2577628..2578614)
Genome map
AA seq 328 aa AA seqDB search
MSLHLLHQFPRLELLGAPTPLEHLPRLSDYLGRDIFIKRDDFTPVALGGNKLRKLEFLAA
DALREGADVLLTAGAIQSNHVRQTAAVAARLGLKCVALLENPIGTDAPNYLSNGNRLLLD
LMDVEVVMVAALHNPAAQLAEQAERLEAQGFRPYVVPVGGSNALGALGYVECAQEIAHQS
EGVVDFAAVVVASGSAGTHAGLAIGLEQLLPDSELVGVTVSRKVADQLPVVERIRTALAQ
QLEVEAHAPITLWDDYFAPRYGEPNEEGMEAVKLLARLEGIMLDPVYTGKAMAGLIDGVS
QQRFRREGPLLFVHTGGSPALFAYHPSV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
ttgtccttacatctattgcaccaattccctcgtcttgagttgttgggtgcacccacaccg
ctagaacatttgccccgtctttctgactatcttggccgtgatattttcatcaaacgcgat
gatttcaccccggtggcacttggcggtaacaaactgcgtaaacttgaatttcttgccgct
gacgcgctgcgtgaaggcgctgatgtgctgctgactgccggggcgattcaatcaaatcat
gtgcgccagacggcggcggtggcggcgcgtctcggcctgaagtgcgtggcgttgctggaa
aatccgattggcaccgatgcgcccaattacctcagcaacggcaaccgcctgctgttggat
ttgatggatgttgaggtggtgatggtggcggcgttgcataatccggcggcgcagttggcg
gagcaggctgaacgcctcgaagcgcagggttttcgtccttatgtggtgccggtcggcggc
tccaatgcgctgggtgcgctcggttatgtggaatgcgctcaggagatcgctcaccaaagc
gaaggggtggtggattttgctgctgtggtggtggcatctggtagtgctggcacccatgcc
ggtctggcgattggtctggagcagttgctgccggacagcgagctggttggcgtgacggtg
tcgcgtaaagtggcggatcaattgccggtggttgagcgcattcgcactgcactggcacag
cagctggaagtggaggcgcatgcgccgattacgctgtgggatgattattttgccccacgc
tacggcgagccgaatgaagagggtatggaagccgtaaaactgctggcgcgcctggaaggc
attatgcttgatccggtatataccggaaaagccatggcgggcttgatcgacggcgtcagt
cagcaacgtttccggcgcgaaggtccgctattgtttgtgcacaccggcggatcgccagcg
ttatttgcttatcatccttcggtctga

DBGET integrated database retrieval system