KEGG   Pantoea sp. At-9b: Pat9b_2585Help
Entry
Pat9b_2585        CDS       T01386                                 

Definition
nucleotidyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pao  Pantoea sp. At-9b
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pat9b_2585
   00052 Galactose metabolism
    Pat9b_2585
   00500 Starch and sucrose metabolism
    Pat9b_2585
   00520 Amino sugar and nucleotide sugar metabolism
    Pat9b_2585
Enzymes [BR:pao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pat9b_2585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2821217..2822113)
Genome map
AA seq 298 aa AA seqDB search
MTKLKAVIPVAGLGMHMLPATKAIPKEMLPVVDKPMIQYIVDECVAAGIKEIVLVTHASK
NAVENHFDTTYELEALLEARVKRQLLSEVQSICPPGVTIMNVRQANPLGLGHSVLCARPM
IGDNPFVVVLPDVLLDDSTADHLRYNLAAMVARFEETGRSQVLATHMPGADLSEYSVITT
EQPLDNPGDVSTITNFVEKPEEANTLDSDLAAVGRYVLSADIWAELERTEPGAWGRIQLT
DAIAALGKKKPVDATLLTGTSFDCGRKLGYMQAFVSYGLRNNSQGRDFRAAIQKILAK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagcttaaagctgtaatcccggttgcgggtctcggtatgcatatgctccctgcg
acgaaagcaattccaaaagagatgctgcctgtcgtcgacaaaccgatgatccaatatatc
gttgatgagtgcgtggctgcaggcatcaaggagattgtgctggtcactcatgcttccaaa
aatgcagtggaaaaccactttgacaccacctatgagcttgaagccttgcttgaagcgcgt
gttaaacgtcaactgctgagcgaagtgcaatcaatttgtcctccgggcgtgaccatcatg
aacgtgcgtcaggctaacccgcttgggctgggccactccgttctgtgcgcacgaccgatg
attggtgataacccgtttgttgtggtgctgccggacgtactgctggacgactccaccgct
gaccacctgcgctacaacctggcggccatggtcgctcgttttgaggaaaccggccgcagc
caggtattggcaacacatatgccgggtgccgatctctctgaatactcagtgatcaccacg
gaacagccattggataaccctggcgacgtcagcaccatcaccaactttgttgagaagccg
gaagaagccaacacgctggattccgatctcgcggcggtcggtcgctatgtgctctctgcc
gatatctgggcagaactggagcgcaccgagccaggtgcctggggccgtatccaactgact
gatgccatcgctgcgcttggcaagaaaaaaccggttgatgcgacgttgctcactggcacc
agcttcgactgtggccgtaaactaggctacatgcaggctttcgtctcttacggtctgcgt
aataacagccagggccgtgacttccgcgccgcaattcagaaaatcctggcgaaataa

DBGET integrated database retrieval system