KEGG   Pantoea sp. At-9b: Pat9b_2786Help
Entry
Pat9b_2786        CDS       T01386                                 

Definition
(GenBank) fatty acid oxidation complex, alpha subunit FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00071  Fatty acid degradation
pao00280  Valine, leucine and isoleucine degradation
pao00281  Geraniol degradation
pao00310  Lysine degradation
pao00362  Benzoate degradation
pao00380  Tryptophan metabolism
pao00410  beta-Alanine metabolism
pao00640  Propanoate metabolism
pao00650  Butanoate metabolism
pao00903  Limonene and pinene degradation
pao00930  Caprolactam degradation
pao01040  Biosynthesis of unsaturated fatty acids
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01120  Microbial metabolism in diverse environments
pao01130  Biosynthesis of antibiotics
pao01200  Carbon metabolism
pao01212  Fatty acid metabolism
Module
pao_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Pat9b_2786
   00650 Butanoate metabolism
    Pat9b_2786
  Lipid metabolism
   00071 Fatty acid degradation
    Pat9b_2786
   01040 Biosynthesis of unsaturated fatty acids
    Pat9b_2786
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Pat9b_2786
   00310 Lysine degradation
    Pat9b_2786
   00380 Tryptophan metabolism
    Pat9b_2786
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Pat9b_2786
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Pat9b_2786
   00281 Geraniol degradation
    Pat9b_2786
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Pat9b_2786
   00930 Caprolactam degradation
    Pat9b_2786
Enzymes [BR:pao01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Pat9b_2786
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Pat9b_2786
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Pat9b_2786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ADU70086
JGI: Pat9b_2786
UniProt: E6WBN0
Position
complement(3057658..3059787)
Genome map
AA seq 709 aa AA seqDB search
MSDSAFHLHMRLDHIGVITIDVPGEKMNTLKAEFVPQIQAVLAEARRDPELAGLVLISGK
RDNFVAGADISMIDRCRSAEEAEALARQGQEVMAAIAALPFPVVAAIHGACLGGGLELAL
ACDARICSLDDKTRLGLPEVQLGLLPGSGGTQRLPRLIGVQQALPLILTGKQLRAKQALK
LGLVDDAVPQSILLETALARVRQGKKTLRTLPCRDRLLQGPIARQVLFALAKRQTDSKTH
GNYPAADRILQVVRTGLEQGSSAGHEAEARAFGQLAMTRESLALRSLFFASTAIKKEAFA
DAAPRELQHIGILGGGLMGGGIASVTALQAGLPVRIRDINLSGINHALQYSWDRLTQRVK
RRQIKTAQRQQQMALISGTQDYQGFSRRDLVIEAVFEDLALKQQMVAEIESHCQSHTIFA
SNTSSLPIGEIAANAQRPENVIGLHFFSPVDKMPLVEVIPHATTSAATLATTVQLARQQG
KTAVVVADKPGFYVNRILAPYINEAMRCLLEGEPIEHIDRALVKFGFPVGPLQLLDEVGI
DVGSKISPILQQAYGDRFSAPEAVAAILADDRKGRKNGKGFYLYQRARFPMKRRADASLY
HLLGIKPQARQSEEQIATRCVMMMLNEAARCLDEAVIRSARDGDIAAVFGIGFPPFLGGP
FRYMDQLGAAEMVNTLNVLMQRHGDRFAPCDALMTALQEQTKFYTSAQI
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgagtgattccgcatttcacctgcatatgcgcctcgatcacatcggggtgatcaccatt
gatgtgccgggcgagaaaatgaacaccctgaaggctgaatttgttccgcagatccaggcg
gtgctggcggaagcgcgacgcgatcctgagctggctggactggtgctgatctccggtaag
cgtgacaactttgtggctggcgcggatatcagcatgatcgaccgctgccgcagcgcagaa
gaggctgaggcgttggcgcgtcaggggcaggaagtgatggcggcgattgccgccttgccg
tttccggtggtggcggcgattcacggtgcctgtctgggtggcgggctggaactggcgctg
gcctgcgatgcacgcatttgctcgctggatgacaaaacccgtctgggtttaccggaagtc
cagttagggcttttgcctggctctggcggcacgcagcgtttgccacggctgattggtgtg
cagcaggcactgccgctgatcctgaccgggaaacagctgcgggcgaagcaggcattaaag
ttggggctggttgatgatgcggtcccacaatccattctgctggaaaccgcgcttgcgcgg
gtgcggcaggggaaaaagaccctgcggacgctgccgtgtcgtgatcggctgctacaaggg
ccgatcgcccggcaagtgctgttcgcgctggcaaagcgccagaccgacagcaaaacccac
ggcaactatcccgcagccgatcggattttgcaggtggtgcgcaccgggctggagcagggc
agtagcgccgggcatgaggcagaagcgcgcgcgtttggtcaactggcgatgacgcgcgaa
tcgctcgcgctacgcagtttattcttcgcctctaccgcgataaagaaagaggcgtttgcc
gatgccgcaccgcgcgagctgcaacatatcgggattctcggtggtgggttgatgggcggc
ggtattgccagcgtcacggctttgcaggccggattgccggtgcgtattcgtgacattaac
ctcagtggcatcaatcatgcgttgcaatacagttgggatcgcctcacgcagcgggtgaaa
cgccgccagatcaaaacggcccagcgtcagcaacagatggcgttgatcagcggtactcag
gattatcagggcttttcccgacgcgatctggtgattgaggcggtatttgaagatctggca
ctgaagcagcagatggtggcggaaattgaaagccattgccagtcacataccatttttgcc
tccaacacttcatcgctgccgattggcgagattgctgccaatgcacagcgcccggagaac
gttatcggcctgcatttctttagcccggtggacaaaatgccgttggtggaggtgatccct
cacgccacaacctccgctgcgacgctggcgaccacagtgcaactggcgcgtcagcagggt
aaaaccgctgtagtggtggcagataaaccgggcttctacgtcaaccgaattctggcaccc
tatataaatgaagcgatgcgctgcctgctggaaggcgagccgatcgaacatatcgatcgg
gcgctggtgaagtttggttttccggtcggcccgttgcaactgttggatgaggtggggatc
gatgttggcagcaaaattagcccgatcctgcaacaggcatatggcgatcgctttagcgcg
ccggaggcggtggcggcgattctggctgacgatcgcaaaggacggaaaaacggcaagggc
ttctatttatatcaacgcgcacgtttcccgatgaaacgccgggctgatgcgtcgctttac
cacctgctgggcatcaaaccgcaggccaggcaaagcgaggaacaaattgccacgcgctgc
gtcatgatgatgctgaatgaggctgctcgctgtctggacgaagcagtgattcgcagcgca
cgcgatggcgacattgccgcggtatttggcatcggttttccgccgttcctcggcgggcct
ttccgctatatggatcagttgggtgctgctgaaatggtcaatacattaaacgtcttaatg
cagcgacacggcgatcgtttcgcaccttgtgacgcactgatgacagcgctacaagaacaa
acgaaattttacacttccgcacaaatctga

DBGET integrated database retrieval system