KEGG   Pantoea sp. At-9b: Pat9b_2873Help
Entry
Pat9b_2873        CDS       T01386                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00300  Lysine biosynthesis
pao01100  Metabolic pathways
pao01120  Microbial metabolism in diverse environments
pao01230  Biosynthesis of amino acids
Module
pao_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Pat9b_2873
Enzymes [BR:pao01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Pat9b_2873
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: ADU70173
JGI: Pat9b_2873
UniProt: E6WCX7
Position
3156348..3157475
Genome map
AA seq 375 aa AA seqDB search
MFCPVIELAQQLIRRPSLSPDDAGCQALLIARLEAIGFQVEPMHIGDTLNFWATRGQGET
LAFAGHTDVVPPGDANRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAAHPN
HQGRLAFLITSDEEASAVNGTVKVVERLMARNERMDYCLVGEPSSTEVVGDVVKNGRRGS
ITANLTIHGVQGHVAYPHLADNPVHRAMPALNELVATEWDQGNEFFPPTSMQIANVKAGT
GSNNVIPGEFFVQFNFRFSTELTDQMIRERVAALLDRHQLRYTLEWNLSGQPFLTSRGKL
VDAVVNAVAHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVKASDLQ
MLSRMYQRIMEQLIA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgttctgtccggttattgagctggctcagcagctgattcgccgcccttccctcagtccg
gatgatgcgggttgccaggcgctgctgattgcccgattggaggcgattggcttccaggtg
gagccgatgcacattggcgatacccttaacttctgggcaacgcgtggtcagggtgagacc
ctggcatttgccggtcataccgacgtggtgccacctggtgatgccaaccgttggattaac
ccaccgttcgagccaaccatccgtgatggcatgttgtttggtcgtggtgctgcggatatg
aaaggctcactggcggcaatggtggtggcggcggaacgctttgtcgcggcccatcccaat
catcaagggcggttggcctttttgatcacttctgatgaagaagccagcgccgtcaacggc
acggtgaaggtggtcgaacgcctgatggcgcgtaatgaacgcatggactactgcctggtg
ggtgagccatccagtaccgaagtggtcggcgatgtggtgaaaaatggccgtcgcggctcc
atcaccgctaacctgaccattcacggcgtgcagggtcacgtggcttacccacacctcgca
gacaacccggtgcatcgcgccatgcccgcgctgaatgaactggtggctaccgagtgggat
cagggcaatgaattcttcccgcccaccagcatgcagattgccaacgtcaaagcgggcacc
ggcagcaacaacgtgattcccggcgaattttttgtccagttcaacttccgcttcagcacc
gaactgaccgatcagatgatccgcgagcgcgtggccgccctgctggatcgccaccaactg
cgctacacgctggagtggaatctttccggccagccgttcctgacttcacgtggcaagctg
gtggatgccgtggtgaacgcggtagcacactataatgagatcaagccgcagttgctgacc
accggcggtacctccgacggacgctttatcgctcgtatgggcgcgcaggtggtagaactc
ggcccggtgaacgccaccattcataaaatcaatgaatgcgtgaaggcgtcagatttgcag
atgctgagccgcatgtatcagcgcatcatggaacaactgatcgcctga

DBGET integrated database retrieval system