KEGG   Pantoea sp. At-9b: Pat9b_3303Help
Entry
Pat9b_3303        CDS       T01386                                 

Definition
proline dehydrogenase (EC:1.5.99.8)
Orthology
K00318  
proline dehydrogenase [EC:1.5.-.-]
Organism
pao  Pantoea sp. At-9b
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:pao00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3638704..3639612)
Genome map
AA seq 302 aa AA seqDB search
MHFIDVLVARSLPFIPRAIVKRLSTRYLAGSTLEEALQVIHNLNRAGFGVTLDVLGESAT
SAAEADAMNAAYATAIAAIAANNLDAELSIKPSALGLLNDEAQCEARIRQILAQATQVAK
TATLDMEDLQCTQKELDLLSRLQPHYPDLGIAVQAYLQRSYADINQLMATRSRLRICKGI
YQENPQFLVAEASRDRSAINPHFLAHVKRCFAEGLFVSVATHDEALIEAVVALSKQHHVA
PDAFEFQMLLGVCEPLRDKVRALGFAVRVYVPYGADWYGYSTRRLQENPRIAGYILRALI
KR
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcattgatgtgttagttgcccgtagtctgccttttattccacgcgctatcgtt
aagcgtctttccacacgttatctggccggttccaccctggaagaggcgttgcaggtcatt
cacaacctgaatcgtgccgggtttggcgtgacgctggatgtgctgggcgaatctgccact
tctgcggctgaagctgatgccatgaacgccgcctatgccacagcgattgccgcaattgct
gccaataatcttgatgctgaattgtcgattaaaccttcggcgttagggttactgaatgat
gaagcgcagtgcgaagcgcgcattcggcagatcctggcgcaggcgacacaggtagcgaaa
actgccacattggatatggaagatctgcaatgtacgcagaaagagctggatctgttgagt
cgtttgcagccgcactatcccgatctggggattgccgtccaggcgtatttgcagcgcagc
tatgcggatatcaatcagttaatggccacacgcagccgattacgtatctgcaaaggaatt
tatcaggaaaaccctcagttcctggtggcagaagcgagtcgggaccgctcggcgatcaac
ccccattttctcgctcacgttaagcgctgcttcgctgaagggctgtttgtcagtgtcgcg
acgcatgacgaagcgttgattgaagcggtggtagccttgtcaaaacagcatcatgttgcg
cctgatgcttttgaatttcagatgctgctgggggtatgtgaacccctgcgtgacaaagtg
cgtgccctcggttttgctgtgcgggtgtatgtgccctacggtgccgactggtatggttac
agcacccggcgtttgcaggagaatccgcgcatcgccggctacatattgcgagcattgatt
aagcgctaa

DBGET integrated database retrieval system