KEGG   Pantoea sp. At-9b: Pat9b_3325Help
Entry
Pat9b_3325        CDS       T01386                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
pao  Pantoea sp. At-9b
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:pao00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3662161..3663483)
Genome map
AA seq 440 aa AA seqDB search
MFLPQEIIRKKRDGRELSEAEIRFFINGVRDNSVSEGQIAALAMTIWFHDMSLAERVALT
MAMRDSGTVLNWQALNLNGPIVDKHSTGGVGDVTSLMLGPMIAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPSDDRFREIIKENGVAIIGQTNSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTFEASENLAQAIVGVANGAGCKTTALLT
DMNQVLASSAGNALEVREAVQFLTGEARNPRLLEVTLALCSEMLMSGKLAANDAEARQQL
QRVLDNGQAAEVFGRMVAAQRGPTDFVQRMDHYLPAAMLSKAVYADQPGIVSAMDTRALG
MAVVALGGGRQRASDTIDYSVGFSEMITLGAQADAQRPLAVIHATTEAQWQQAAAAVKAA
ITLSDSAPPETPVVYRRISE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
ttgttcctgccacaagaaattattcgcaaaaaacgcgatggtcgtgaattgagtgaagcg
gagatccgtttctttatcaatggcgtgcgtgataacagcgtatctgagggacaaatcgcc
gcgctggcgatgaccatctggttccacgatatgtcgctggccgaacgcgtggcgctgacc
atggcgatgcgtgattccggcactgtgctgaactggcaggcgctgaacctcaacggtccg
attgtagataaacactcgaccggtggcgtgggcgatgtgacgtcgctgatgcttggccca
atgattgctgcctgcggaggttatgtgccgatgatctccggccgtggcttgggtcacacc
ggcggtacactggataagctggaagcgatccctggttttgacatcttcccgagcgacgat
cgcttccgtgagatcatcaaagaaaatggcgtggcgatcatcggccagaccaactcgctg
gcaccggctgacaaacgtttttacgccacacgcgatattaccgccacggtcgattcgatc
ccgctgatcacggcatcgatcctggcgaaaaagctggcggaagggctggatgcgctggtg
atggatgtcaaagtgggcagcggcgcctttatgccgaccttcgaggcttccgaaaatctg
gcgcaggccattgtgggcgtagccaatggtgcaggctgtaaaaccacggcgctcctgact
gacatgaatcaggtgctggcttccagcgcgggcaacgcactggaagtgcgggaagcggtg
cagttcctgaccggagaagcgcgtaatccacgcctgctggaggtgacgctggcgctgtgc
agtgaaatgctgatgtctggcaagctggcggcaaacgatgccgaggcccgccagcagctg
caacgggtgctggataacggccaggcggcagaggtatttggccgtatggtggcggcacaa
cgtgggccgacagactttgtccagcgtatggatcactacctgcccgccgcgatgctgagc
aaagcggtgtatgccgaccagccaggtatcgtcagcgcaatggatacccgtgcgcttgga
atggctgtggtggcactgggaggcggtcgtcaacgcgccagcgacaccattgattacagc
gttggcttcagcgaaatgatcaccctcggcgcgcaggccgatgcgcagcgcccgctggcg
gtgatccacgccacaaccgaagcgcagtggcagcaggctgccgctgcggtcaaagcggcc
atcaccctgagcgacagcgcaccgccggaaacgccggtggtttatcgtcgcatcagcgaa
tag

DBGET integrated database retrieval system