KEGG   Pantoea sp. At-9b: Pat9b_3427Help
Entry
Pat9b_3427        CDS       T01386                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
pao  Pantoea sp. At-9b
Brite
Enzymes [BR:pao01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Pat9b_3427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3766951..3767466)
Genome map
AA seq 171 aa AA seqDB search
MNLQTVKRCVVGAVLAIAATLPGFQQLHTSVEGLKLIADAEGCRLKPYQCDAGKWTDGIG
NTSGVVPGRSITERQAAGNFITNVLRVEAALARCVAVTMPQQVYDALVSLAFNVGTGNVC
GSTMVALLKKGRWRDACLQLPRWVYVLGVFNQGLDNRRQREQAWCLKGVRG
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgcaaaccgttaagcgatgtgttgttggcgcggtgctggccatcgccgccacg
ctgccgggatttcagcaactgcacacctcagtggaggggctgaaactcattgcagacgcc
gaaggctgccgcctgaagccttaccagtgcgacgcgggcaaatggaccgacgggatcggc
aacacgtccggcgtggtgccgggcaggagcattaccgaacggcaggcggcggggaacttc
atcaccaacgtgttacgcgttgaggcggcactggcgcgctgcgtggcggtcactatgccg
cagcaggtttatgacgcgctggtgtcgctggcgttcaacgtcggcaccggcaacgtgtgc
ggctccacgatggtggcactgctgaaaaaggggcgatggcgggatgcgtgtctgcaactg
ccccgctgggtgtatgtgctgggcgtatttaatcaggggctggataaccggcgtcagcgt
gaacaggcctggtgcctgaaaggagtccggggatga

DBGET integrated database retrieval system