KEGG   Pantoea sp. At-9b: Pat9b_3537Help
Entry
Pat9b_3537        CDS       T01386                                 

Definition
(GenBank) 3'(2'),5'-bisphosphate nucleotidase
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00920  Sulfur metabolism
pao01100  Metabolic pathways
pao01120  Microbial metabolism in diverse environments
pao01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Pat9b_3537
Enzymes [BR:pao01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Pat9b_3537
Transfer RNA biogenesis [BR:pao03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Pat9b_3537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P DcrB
Motif
Other DBs
NCBI-ProteinID: ADU70827
JGI: Pat9b_3537
UniProt: E6WFX2
Position
complement(3877556..3878302)
Genome map
AA seq 248 aa AA seqDB search
MLEQICQLARAAGDAIMQVYNGVQPMDIERKADDSPVTAADLAAHKVIVAGLNSLTPEVP
VLSEEDPPGWEIRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIENGKPVLGVVYAPAI
GVLYSAAEGKAWKEEGGNKTQIHVRDARPPLVVISRSHFDKDEELKEYIQQLGEHQTTAI
GSSLKFCLVAEGKAQLYPRFGPTNIWDTGAGHAVAIAAGAHVHDWTGKTLDYAPRESFLN
PGFRVSLF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgttagagcaaatttgccagctggcgcgtgcggcgggcgatgcgattatgcaggtttat
aacggcgtgcagccgatggatatcgaacgcaaggcggatgattccccggtcacggcagcc
gatctcgccgcacataaagtgattgtcgcgggtctgaatagcctgacaccagaggtgccg
gtcctgtctgaagaggatcctccgggctgggaaattcgtcagcactggcagcgttactgg
ctggttgatccgctcgacggcaccaaagaatttatcaagcgcaatggcgagttcacggtc
aatattgccctgattgaaaatggcaaaccggtactgggggtggtgtatgcccctgcgatt
ggcgtgctgtattccgcggcagaaggcaaagcctggaaagaagaaggcggcaataaaacc
caaattcatgtgcgcgatgcacgtccaccgctggtggtgatcagccgttctcatttcgac
aaggatgaggagctgaaagagtatatccagcaactgggtgagcatcagaccacagccatc
ggttcatcgctgaagttctgtctggtggcagagggcaaagcacagctctacccgcgtttt
gggccgaccaacatttgggataccggtgccggacacgctgtcgcgattgccgcaggcgcg
cacgtgcatgactggaccggtaaaaccctcgattacgccccgcgtgaatctttcctcaac
ccaggctttcgtgtgtcgctgttttag

DBGET integrated database retrieval system