KEGG   Pantoea sp. At-9b: Pat9b_3707Help
Entry
Pat9b_3707        CDS       T01386                                 

Definition
alpha amylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
pao  Pantoea sp. At-9b
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:pao00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4039707..4041395
Genome map
AA seq 562 aa AA seqDB search
MDIINALLDEIYAGTFPVAARERLLSHIRAARDTVKIPRKPHWDEKDVVLITYADQLREP
DVPTLATFSRFYQQHLQGTFSLVHLLPFFPYSSDDGFSVIDYHQVNPICGEWQHVAALHT
HTRLMFDFVCNHMSAHSSWFRHFLAQDPGWDDFFISMPPATDLSGVTRPRTSPLLTPFEM
ADGATRFIWTTFSADQIDLNFANPEVLIRMVNVLLDYLKKGADYVRLDAVGYMWKTPGTN
CIHLPKTHQLVKLFRAIANVVAPGTVIVTETNVPHKDNISYFGNGHDEAQMVYQFSLPPL
VLHAIHSGSGRALRQWASSLDIGSGDTTFFNFLASHDGIGLNPARGILSEVEIVALVRDL
ALEGALVSYKNNPDGTTSPYEINVTYLDALNRQDDDDNTRLRRFLLAHAILLAFPGVPAI
YIQSILGSRNDNEGVHAAGHNRAINREKFSLHEMEQFLSGGNALRQQVFERLSALIQLRT
RQPVFHPDNPMTLFDSDNALLVLRRYKPDSQEALLCVFNLSGREIETMLPQARQFHDLIS
GENINGNQPVRLAAWQFMWLKG
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggatattatcaacgccttacttgatgagatttacgcaggtaccttccctgtggcggct
cgtgagcgtctgctttcccacatacgtgcagcacgggataccgtcaaaatcccccgtaaa
ccgcactgggatgagaaggatgtggtgcttattacttacgccgaccagttgcgtgagccg
gatgtgcccacccttgccaccttctcgcgcttttatcagcaacacctgcaaggcaccttt
tctctggtccatctgctgccgttttttccttactcctcggacgacggcttctcggttatc
gactatcaccaggtcaacccgatttgcggcgaatggcaacacgtggcggcattgcatacc
catacgcggctgatgttcgattttgtctgtaaccacatgtccgcacacagtagctggttt
cgccacttcctggcgcaggaccccggctgggatgatttctttatcagcatgccccccgcg
accgaccttagtggcgtgacccgcccgcgcacctcgccgttgctgacgccattcgaaatg
gccgatggtgctacgcgttttatctggaccaccttcagcgctgaccaaatcgatctcaac
ttcgccaatccggaagtgctgatccgcatggtcaacgtgttgctcgattatctgaagaag
ggtgccgactacgtgcggcttgatgcggtgggctatatgtggaaaacgccgggcaccaac
tgcatccatctgccgaaaacccatcaactggtgaagttgtttcgcgcgattgccaatgtg
gtggcaccgggcacggtgatcgttactgagactaacgtgccacacaaagacaacatcagt
tattttggcaacggccatgacgaagcacagatggtgtatcagttttcgttgccgccgctg
gtgctgcatgccatccactccggctcagggcgcgcgctgcgtcaatgggccagttcgctc
gatattggcagcggtgataccaccttctttaactttctcgcctcccatgatggcattggc
ctcaatccagcgcgcggcattttgtcggaagtggagattgtggcgctggtgcgtgacctg
gcgctggagggcgcgctggtttcctataaaaacaacccggacggcaccaccagcccgtat
gaaatcaacgtcacttatctggatgcactaaatcgtcaggatgatgatgacaatacgcga
ctacgccgtttcctgctggctcacgccatcctgttggcttttcccggcgtgcccgccatc
tatattcaaagcatcctcggttcacgtaacgacaacgaaggggtacatgccgccggacat
aaccgcgccatcaatcgggaaaagttcagcttgcacgaaatggagcagtttctcagtggt
ggcaatgcgctgcgccagcaagtgtttgaacgcctcagtgcgctgatccagttacgcaca
cgtcagcccgttttccatcccgacaacccaatgacgttgttcgacagcgataacgcgttg
ctggtgctgcgccgttacaaacctgacagccaggaagcgctactgtgcgtatttaatctc
agcggacgtgagattgagacgatgttgccgcaggcacggcagtttcacgatttaatcagt
ggggagaatattaatggcaaccagcctgtgcgactggctgcctggcaatttatgtggcta
aaaggctaa

DBGET integrated database retrieval system