KEGG   Pantoea sp. At-9b: Pat9b_3741Help
Entry
Pat9b_3741        CDS       T01386                                 

Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
pao  Pantoea sp. At-9b
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pao00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4081789..4082772
Genome map
AA seq 327 aa AA seqDB search
MSMSDFSLIQRPRRLRKSAAMREMFQETSLSLSDLALPIFVEEGVDDYKPITAMPGVMRI
PEKRLAYEIERIAKAGIRSVMTFGISHHTDATGSDAWNENGLVARMSRICKETVPEMIVM
SDTCFCEYTSHGHCGVLCDHGVDNDATLINLGKQAVVAAQAGADFIAPSAAMDGQVKAIR
QALDAAGFTDTAIMSYSTKFASSFYGPFREAAGTALKGDRKTYQMNPMNRREAIRESLID
EAEGADSLMVKPAGAYLDILRDIRERTTLPLAAYQVSGEYAMIKFAAQAGAIDERNVVLE
SLGAIKRAGADLIFSYFALDLAEQKML
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgtctgatttttcccttatccagcgtccaagaaggctgcgtaaaagcgccgcg
atgcgtgaaatgttccaggaaaccagcctgagcctcagcgatttggccctgccgatcttc
gttgaagaaggggtggacgattacaaacccattaccgcgatgcccggcgtgatgcgtatt
ccagaaaaacgcttggcatatgaaatcgaacgtatcgccaaagcgggtatccgttcggtg
atgaccttcggtatctcacatcataccgatgccaccggcagcgatgcctggaacgaaaac
ggtctggtggcgcgtatgtcgcgtatctgcaaagaaaccgtgccggaaatgatcgtcatg
tccgacacctgtttctgcgaatacaccagtcacggccactgcggtgtgctgtgcgaccac
ggcgtcgataacgatgcaaccctgattaaccttggcaagcaagcggtggttgctgcacaa
gccggtgccgattttattgcaccgtcagccgcgatggacggccaggttaaagccattcgc
caggcactcgacgccgccgggtttaccgataccgcgatcatgtcgtactccaccaagttt
gcctcctccttctatggcccgttccgtgaagcggcggggacggcactgaaaggcgatcgc
aaaacttatcagatgaatccgatgaaccgccgcgaagcgattcgcgagtcgctgattgat
gaagcggaaggggccgattcgctgatggtgaaaccagccggagcctacctcgacatcctg
cgtgatatccgcgagcgcactacgctgccgctggcggcctaccaggtcagtggtgaatac
gcgatgatcaaattcgccgcacaagccggtgccattgatgaacgcaatgtggtgctggaa
agccttggtgccattaagcgcgccggtgccgatctgattttcagttattttgcccttgat
ctcgccgagcaaaaaatgctctga

DBGET integrated database retrieval system