KEGG   Pantoea sp. At-9b: Pat9b_3816Help
Entry
Pat9b_3816        CDS       T01386                                 

Definition
family 5 extracellular solute-binding protein
Orthology
K13889  
glutathione transport system substrate-binding protein
Organism
pao  Pantoea sp. At-9b
Pathway
ABC transporters
Module
Glutathione transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:pao02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4159782..4161323)
Genome map
AA seq 513 aa AA seqDB search
MNPFFRRTSLALGLTLSLAAAAQAQDLHISMYADITGLDPHDTSDNVSYSVQSGIFERLF
QFDAQMKLQPWLATSYTSNDSATEFTLTLRKGVTFQDGTPFDAEAVKANLDRLADQTKGL
KRNSLYKMIAKVTVLAPDQVKVELNQSFGAFINTLAHPSAVMWSPAILKQYPDEAQLRLH
PVGTGPFKFVDWQPGKAVDLTKYAGYWQKGWPKVDNVTFSPSPEDATRVAALKSGQVDAI
WPLPSDLISTVQSDSKLAIQRDPSIYLYYMAINTQHKPLADLRVRQAINYAIDRNLWLKV
AFAGMGKPASSAIPEGVQFYQKQSDPNYRYAPDEAKALLKAAGYPNGLDLKLWTTNATAS
VRAAQFLKAQLATAGIRVTVTPMDSGTRNAKLWGVKDPKQAEFDLYYGGWSTSTGDADWA
LRPLYATESWVPTSYNVSYYSNPAVDKAIAGGLATADPAKRGVAYAEAQKLLWKDAPVAF
LGTPDNLVGKRSNLSGVSMLPDGNFLYTQAAFK
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtttttccgtcgcacctcgctcgctctcggacttaccctctccctggcggct
gccgcacaggcgcaggatctgcacatctcaatgtatgccgatatcaccggcctcgatccg
cacgatacctcagacaacgtcagctattcggtacagagcggtatctttgagcgcctgttc
cagttcgatgcccagatgaagctgcaaccctggctggcgaccagctataccagcaacgac
agcgccaccgagttcaccctgacgctgcgtaaaggcgtcaccttccaggacggtacgccg
ttcgatgcggaagcggtaaaagccaaccttgatcgcctcgccgatcagaccaaaggcctg
aagcgcaacagcctgtacaagatgatcgcgaaagtcacggtgctggccccggatcaagtg
aaagttgaactgaatcagtcatttggtgcctttatcaacaccctggcgcatccgtcggcg
gtgatgtggagcccggcaatcctgaagcagtacccggacgaagcgcagctgcgtctgcat
ccggtgggtactggtccgtttaagtttgtcgactggcagccgggtaaagcggtggatctg
accaaatacgctggttactggcagaaaggctggccgaaagtcgataacgtcaccttctca
cccagcccggaagatgccacgcgtgtcgcggctcttaagtcagggcaggtggatgcgatt
tggccattgccgtccgatctgatcagcaccgtgcagagcgacagcaagctggcgatccaa
cgcgatccgagcatttacctctactacatggcgatcaacacccagcacaaaccgctggcg
gatctgcgtgtgcgtcaggcgatcaactacgccatcgatcgtaacctgtggctgaaagtg
gcgtttgctggcatgggcaaaccggccagctccgccattccagaaggggtgcagttctat
cagaagcaaagcgacccgaactaccgttacgcgccggatgaagccaaagcgttgttgaaa
gcggcgggttatccgaacggtctggatctgaagctgtggaccaccaatgccaccgccagc
gtgcgtgcggcgcaattcctgaaagcgcagctggcgaccgcaggtatccgcgttaccgtg
acgccgatggactccggtacgcgtaacgccaaactgtggggcgtgaaagatccgaagcag
gcggaatttgacctctactacggcggctggtcgacctccaccggcgatgctgactgggcg
ctgcgtccgctgtacgccaccgaatcctgggtaccgacctcgtacaacgtgtcgtactac
agcaacccggcagtggacaaagcgattgccggtggcctggcaaccgctgatccggccaaa
cgtggcgtggcttatgccgaagcccagaagttgctgtggaaagacgcgccggtggccttc
ctcggtaccccagacaacctggtgggtaaacgcagcaacctgagcggcgtgtcgatgctg
ccagatggcaacttcctgtatacccaggcagcgtttaagtaa

DBGET integrated database retrieval system