KEGG   Pantoea sp. At-9b: Pat9b_3875Help
Entry
Pat9b_3875        CDS       T01386                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00010  Glycolysis / Gluconeogenesis
pao00051  Fructose and mannose metabolism
pao00562  Inositol phosphate metabolism
pao01100  Metabolic pathways
pao01110  Biosynthesis of secondary metabolites
pao01120  Microbial metabolism in diverse environments
pao01130  Biosynthesis of antibiotics
pao01200  Carbon metabolism
pao01230  Biosynthesis of amino acids
Module
pao_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pao_M00002  Glycolysis, core module involving three-carbon compounds
pao_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pat9b_3875
   00051 Fructose and mannose metabolism
    Pat9b_3875
   00562 Inositol phosphate metabolism
    Pat9b_3875
Enzymes [BR:pao01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pat9b_3875
Exosome [BR:pao04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pat9b_3875
  Exosomal proteins of bladder cancer cells
   Pat9b_3875
  Exosomal proteins of melanoma cells
   Pat9b_3875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADU71165
JGI: Pat9b_3875
UniProt: E6WAG6
Position
4235974..4236741
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSKHMTEELIAGLRKELSGVEGCGVAIAPPALYLGQAKHAISGSHIA
LGAQNVDVNLSGAFTGETSADMLKDIGAKYIIIGHSERRTYHKESDEFIAKKFAVLKAAG
LVPVLCIGETDAENEAGKTEEVCARQIDAVLETQGAEAFQGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKKDAAVAAQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAAAKNA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccactggttatgggtaactggaaactgaacggcagcaaacacatgacggaa
gagctgatcgcaggtttgcgtaaagagctgtcaggtgttgagggttgcggcgtggcaatt
gcgccaccggcactctaccttggccaggcgaaacatgccatttccggtagccacattgct
ctgggtgctcagaacgtggacgtcaacctgtctggtgctttcaccggcgaaacttcagca
gacatgctgaaggacatcggtgccaaatacatcatcattggccattctgagcgtcgtact
taccacaaagaaagcgacgagtttatcgcgaagaaatttgccgtgctgaaagccgctggc
ctggtgccggtgctgtgcattggtgaaaccgacgccgagaacgaagcgggcaaaactgaa
gaagtttgcgcacgtcagatcgacgcagtgctggaaactcagggtgcagaagccttccag
ggtgccgtgattgcctacgaaccggtgtgggcgattggtactggtaaatcagcaaccccg
gctcaggcccaggcggtgcataaatttattcgtgaccatatcgcgaagaaagatgccgca
gttgcagcacaggtcatcattcagtacggcggttctgtgaatgataaaaatgccgcagaa
ctgtttactcagccagacatcgatggcgcgctggttggcggtgcgtcactgaaagctgat
gcttttgccgtgatcgtcaaagccgcagcggcagcgaaaaacgcctaa

DBGET integrated database retrieval system