KEGG   Pantoea sp. At-9b: Pat9b_3875Help
Entry
Pat9b_3875        CDS       T01386                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pao  Pantoea sp. At-9b
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pat9b_3875
   01230 Biosynthesis of amino acids
    Pat9b_3875
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pat9b_3875
   00051 Fructose and mannose metabolism
    Pat9b_3875
   00562 Inositol phosphate metabolism
    Pat9b_3875
Enzymes [BR:pao01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pat9b_3875
Exosome [BR:pao04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pat9b_3875
  Exosomal proteins of bladder cancer cells
   Pat9b_3875
  Exosomal proteins of melanoma cells
   Pat9b_3875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4235974..4236741
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSKHMTEELIAGLRKELSGVEGCGVAIAPPALYLGQAKHAISGSHIA
LGAQNVDVNLSGAFTGETSADMLKDIGAKYIIIGHSERRTYHKESDEFIAKKFAVLKAAG
LVPVLCIGETDAENEAGKTEEVCARQIDAVLETQGAEAFQGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKKDAAVAAQVIIQYGGSVNDKNAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAAAAKNA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatccactggttatgggtaactggaaactgaacggcagcaaacacatgacggaa
gagctgatcgcaggtttgcgtaaagagctgtcaggtgttgagggttgcggcgtggcaatt
gcgccaccggcactctaccttggccaggcgaaacatgccatttccggtagccacattgct
ctgggtgctcagaacgtggacgtcaacctgtctggtgctttcaccggcgaaacttcagca
gacatgctgaaggacatcggtgccaaatacatcatcattggccattctgagcgtcgtact
taccacaaagaaagcgacgagtttatcgcgaagaaatttgccgtgctgaaagccgctggc
ctggtgccggtgctgtgcattggtgaaaccgacgccgagaacgaagcgggcaaaactgaa
gaagtttgcgcacgtcagatcgacgcagtgctggaaactcagggtgcagaagccttccag
ggtgccgtgattgcctacgaaccggtgtgggcgattggtactggtaaatcagcaaccccg
gctcaggcccaggcggtgcataaatttattcgtgaccatatcgcgaagaaagatgccgca
gttgcagcacaggtcatcattcagtacggcggttctgtgaatgataaaaatgccgcagaa
ctgtttactcagccagacatcgatggcgcgctggttggcggtgcgtcactgaaagctgat
gcttttgccgtgatcgtcaaagccgcagcggcagcgaaaaacgcctaa

DBGET integrated database retrieval system