KEGG   Pantoea sp. At-9b: Pat9b_3927Help
Entry
Pat9b_3927        CDS       T01386                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
pao  Pantoea sp. At-9b
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Pat9b_3927
Enzymes [BR:pao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Pat9b_3927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4283768..4284517
Genome map
AA seq 249 aa AA seqDB search
MRLGLTHKKEMRLTRRQTLRGGRKPCILCRKSTPLFTQFKKIMAQGTLYIVSAPSGAGKS
SLIQALLKTQPLYDTQVSVSHTTRGVRPGEAHGEHYFFVSKPEFEAMIAEDAFLEHAEVF
GNYYGTSRAAIERVLATGVDVFLDIDWQGAQQIRHKMPAARSIFVLPPSTEELDRRLRGR
GQDSEEVIARRMAQAVAEMSHYAEYDYLIVNDDFDLALSDLKTIIRAERLRMSRQKSRHD
ALISKLLAV
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcggctggggctgactcacaaaaaagaaatgcgcctgacgcggcggcaaacgctgcgt
ggcgggcgtaagccgtgtatactgtgcaggaaatcgactccgctctttactcaattcaag
aaaatcatggctcaaggcacgctctatattgtttctgcccccagcggcgcaggtaaatcc
agtctgattcaggcgctgttgaagacacaaccgttatacgatacgcaagtgtctgtttcc
cataccactcgtggcgtgcgccctggtgaggctcatggtgaacattacttttttgtatcg
aaaccggaattcgaagccatgattgccgaggatgccttccttgagcatgcggaagtcttt
ggcaactattacggtacctcccgtgcggccattgaacgcgtactggcaaccggcgttgat
gtttttcttgatatcgactggcagggtgcgcagcaaatccgtcataaaatgcctgccgca
cgcagcatttttgtcttgccgccttcaacggaagagttagatcgccgtttgcgtggccgt
ggtcaggatagcgaagaggtcatcgcccgccgtatggctcaggccgtggcggaaatgagc
cactatgccgaatacgattacttaattgtgaatgatgatttcgatctggcgctgtccgat
ctgaaaaccatcattcgcgcagaacgtctgcgcatgagtcgccagaaatcgcgacatgat
gctttaatcagcaaactattggcagtctga

DBGET integrated database retrieval system