KEGG   Pantoea sp. At-9b: Pat9b_3956Help
Entry
Pat9b_3956        CDS       T01386                                 

Definition
(GenBank) ribokinase
  KO
K00852  ribokinase [EC:2.7.1.15]
Organism
pao  Pantoea sp. At-9b
Pathway
pao00030  Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:pao00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Pat9b_3956
Enzymes [BR:pao01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Pat9b_3956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin Carb_kinase
Motif
Other DBs
NCBI-ProteinID: ADU71246
JGI: Pat9b_3956
UniProt: E6WBX6
Position
complement(4322798..4323727)
Genome map
AA seq 309 aa AA seqDB search
MSKSAKLAVLGSINADHILNLAHFPRPGETVIGKQYQIAFGGKGANQAVAAGRAGANIAF
IACVGADDIGERIRQQLQQDRIDTAPVETVADEATGVAMIFVNGEGENNIGIYSGANAAL
TPACVDRHQQVIADADALLMQLESPLESVLAAAKIAKAQQTQVILNPAPATHLSDELLAL
IDIITPNETEAEILTGIAVKSDEDAARAAAVLHGKGIQTVLITLGRRGVWLSEQGEGVRI
PGFSVQAVDTIAAGDTFNGAFITARLEGVLMHDAVRFAHAAAAIAVTRPGAQPSVPWRTE
IDAFLQQQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaagcgcaaaactggccgtactcggcagcatcaatgccgatcacatccttaac
ctcgcccattttccacgaccaggcgaaacggtgatcgggaaacagtatcagattgccttt
ggcggcaaaggggctaatcaggcggtagccgccggacgcgcgggtgccaatatcgccttt
attgcctgcgtgggtgcagatgacattggcgaacgtatccgccagcagttgcagcaggac
cgaattgatactgcgccggtggaaaccgtcgcggatgaagccaccggtgtggcgatgatc
ttcgtgaatggcgaaggtgaaaacaatatcggcatctattctggtgctaatgcggcgtta
acgccggcctgtgttgatcgtcatcaacaggttatcgcggatgctgatgcgttgttgatg
caattagagtcaccgctggaaagcgtgctggcggcggcgaaaatcgccaaagcgcagcaa
acgcaggtgattcttaatccggcccctgccacccatctttccgatgaactgttggcactg
atcgatatcatcacgccaaacgaaaccgaagcggaaatcctgaccggcatcgcagtgaaa
agcgatgaagatgcggcgcgggcggcggcagtgctgcatggtaaaggtatccagacggtg
ctgattaccctgggccgtcgtggtgtctggttgagcgagcaaggcgagggtgtgcgcatt
cctggctttagcgtacaggcggtcgacaccattgcagcgggcgataccttcaacggcgcg
tttattaccgcccgtctggaaggggtcttgatgcatgatgcggtacgttttgcccatgcg
gcggccgccatcgccgtgacgcgccccggggcgcaaccctcggtgccgtggcgtaccgag
attgatgccttcctgcaacaacagggctaa

DBGET integrated database retrieval system